SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016424 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016424
Domain Number 1 Region: 430-540
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000108
Family PWWP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016424   Gene: ENSSHAG00000013975   Transcript: ENSSHAT00000016561
Sequence length 753
Comment pep:novel scaffold:DEVIL7.0:GL841422.1:1364581:1390897:-1 gene:ENSSHAG00000013975 transcript:ENSSHAT00000016561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDTQYVLCRWKKRLWPAKVLPQTGLSTRKHIQKMRSAFLNVEILSLDKKIKVKKTETKI
LEKSQIEEIAAELTTQVEIKTTPKEELIYRRSLKFGLDVLSQKADAIEANSLSKSLTTPV
LHKLKQTRPAHAVSESDSSPFVCEEVVGGSGPFKKENVLQRLSSSPIEENKCKKGLKRSV
RIYGNKTEPLASPARNIFGTQKLQHQKSEIPKSWSRTGKNQKQKKDDSSQNLQLNLKKKL
EIKDSGKKGRKRPRISNRYSSPFNAREEDDTNTELGELSPVLSSSNSIHLMALEKKTSSS
SRKALDFSTNRSFVESECENELGKVPSLKYCKVLNGIKQSSVSECHCLEPEEIGLCTNGS
DTPPGVSNCSLVCPNYFAPKTRTLKLPDFEDDEEELQSSEQSLEFSSVNTTVVDEEEEDE
ELPSILSRPEPCSIEAGMLVWCKYQKYPYWPSVVKSVKRKDKKASILYIEGNMNPEKRGF
TVSLRRLKHFDCEEKQELMDKAKEDYSQGVDWCIMLISDYRIRIGCGSFVGSFLEYYSAD
ISCPVRKVIQQAPIKTVFPILNKEEPEDGLSDTSLNKKQSFKKVLPDRRRAARDKANEKL
VEYIVNEKGAENHLLAILKSRKKSRWLKEFLNSSQYMTCVETYLEDDEQLYLVVKYLQEV
YQEIDSKMLTLINGDGIKFILDVLLPEAIIYAISAIDEIDYQTAEKKYIEGPSVSKRERE
MFDKELLEEKKKELTLLKTETSFPEMSPDVSKL
Download sequence
Identical sequences G3WLW9
XP_012397680.1.9362 XP_012397681.1.9362 XP_012397682.1.9362 XP_012397683.1.9362 ENSSHAP00000016424 ENSSHAP00000016424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]