SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016711 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016711
Domain Number 1 Region: 282-527
Classification Level Classification E-value
Superfamily SIS domain 5.72e-19
Family mono-SIS domain 0.0066
Further Details:      
 
Domain Number 2 Region: 29-192
Classification Level Classification E-value
Superfamily SIS domain 0.000000222
Family mono-SIS domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016711   Gene: ENSSHAG00000014217   Transcript: ENSSHAT00000016853
Sequence length 625
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856719.1:1420689:1458490:1 gene:ENSSHAG00000014217 transcript:ENSSHAT00000016853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGTKRFQHVIETPEPGKWELSGYEASLPITEKSNPLTQDLDKANAEQIVQLLGQCDAEI
FQEEGQIMPAYQRLYSESILTTMVHVAGKVHEVLKEPEGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVTAGKKRVIVIGISV
GLSAPFVAGQMDFCMNNSDIFLPVLVGFNPVNMARNDPIEDWNSTFREIAQRMQKLQEKQ
KAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHHTVERDMGARRSCLLEILRTFE
RAHKVTYSQGPKIASLMKQASTSLQKKGRVYLVGWQTLGIIAIMDGVECIHTFGADFQDV
RGFLIGDHSDMFNQKEEIVAQGPQFSFSQEDFLTSILPSLTEKDTVLFIFTLDDNLTEVE
TLVEQVKKKTPNIQALAHSTVGQYLPASLKKLFPSMISITWPLLFFDYAGNFIQKFQREL
STKWVLNTVSTGAHVLCGKILHNHMLDLRLRNSKLFWRGLAMLQRFSEQPKAQCIESLLK
AIHFPQELSEEIREAPISRHIQVAHEKEQVIPKALLTLLFRCSIPEAEAQLAAAPSVCEA
IRNALLRAGRKRHADSLDTLKSTTG
Download sequence
Identical sequences G3WMQ6
ENSSHAP00000016711 ENSSHAP00000016711 XP_003767172.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]