SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016825 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016825
Domain Number 1 Region: 737-829
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.43e-27
Family Tudor domain 0.0012
Further Details:      
 
Domain Number 2 Region: 514-608
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.92e-25
Family Tudor domain 0.002
Further Details:      
 
Domain Number 3 Region: 957-1051
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.71e-24
Family Tudor domain 0.002
Further Details:      
 
Domain Number 4 Region: 284-378
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.18e-20
Family Tudor domain 0.0013
Further Details:      
 
Domain Number 5 Region: 157-203
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000105
Family MYND zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016825   Gene: ENSSHAG00000014311   Transcript: ENSSHAT00000016967
Sequence length 1169
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834463.1:1446571:1520077:-1 gene:ENSSHAG00000014311 transcript:ENSSHAT00000016967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRNNSDISACKVTEQLNIERNEIKPPHEPLRSPRSYPNFKLKSPEHGSKTVGIAKKNFL
FCEQTKRYFASCENSSPPSNSNCINKEAVGSKIDKKTSTGNSVATLNIGNNLPTKELNTK
LSTHLSPAKPKMLQNLSENPLSLNYDSKLFNSLIPSPRSTTCHRCGLYGSLRCSQCKQTY
YCCVACQRRDWSAHSIVCKPIKQNFPKPDDTKLSCETKKMEVNKEDDYQLGITTEIIGST
KKIMFSDLQNLQLRKTMEIKGTVTEFKHPGEFYIQICSSEVLEYIRKLSTSLKESYMNMM
PQEEYIPIKGEICVAKYSVDQTWNRVIVQDVDVQQKKAQVLYIDYGNGEVIPISRIQQLN
KNIELFPPCAIKCFVANVIPAEGSWNNDCTNAIKPLLVEQYCSLKILDILQEEIISFAVD
VLLPGSGKHLDHVLLEMGYGLRPKGQNSKMQSSDKSDFEDSGEKTSKDKTTTECKSNLIP
KVLSLNVGDEFCGVVAHIQTPEDFFCQQLQSGRQLAELQLSLSEYCNKMSTQSDFYPAIG
DICCAQFSEDNQWYRASVLAYASEESALVGYVDYGNFEILKLNRLCPMAPRLLELPMQAI
KCILAGVKPSSGIWSPEAICLMKKLIRNKMITVKVVDKKENSSVVELIDKSIKPSISVSK
ILIEAGFAVGEGKILTTDTSNELREINAPLTVEETVNTFEWTWVELAVNETVNVMVCMLY
NPGEFYCHILKEDALSGLNEVNRSLAEYCQQKMPNEFKPEIGEPCCAYFTGDGNWYRALV
KEILPNATVKVHFVDYGNIEEVTVDKLRKMSSKFLKLPFQGIRCWLVDIKPRNKHWSKEA
TARFQMCVAGIKLKAKIVDLTDNGAGVELTDPSTAYPKIISDILIDEHLVLKDEPPCKDT
QNSKPVDLPFDPDVLQATSSDQWKTIEFPVDEIVPACILEIISPSLFYALPIESRDQEKL
NLMTVKLTDHCNSQKNRALFKPRIGDVCCARFTSDNYWYRAIILKVSESEVKVLYADYGN
IETLPFSRIQPITTIYLELPFQIIRCSFEGIMELEGGWSPLVLEQLKKLMLNQNVMISVK
GIIKNVHAVSVEKRSENGTINIADKLVMEGLAKHIATKNQSVLNKGQTNCCCTELRKQVE
KHEQILLFLLNNPTNQDKFTEMKKLLKIK
Download sequence
Identical sequences G3WN20
ENSSHAP00000016825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]