SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000016845 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000016845
Domain Number 1 Region: 629-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000571
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-36
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-22
Family First domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 3.19e-20
Family PDZ domain 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000016845   Gene: ENSSHAG00000014327   Transcript: ENSSHAT00000016987
Sequence length 922
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849604.1:1451464:1684291:-1 gene:ENSSHAG00000014327 transcript:ENSSHAT00000016987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNLRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASFAIQSELGDYDHSENLPGYLSDYSFIPGQ
PQDFEKEIAKLHQQHLGLSPAEAEFNYLNTARTLELYGVELHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDERLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
DHIVHTSPSEVFVNQRSPSSTQANSIILESSPSQETSEDGQPPALPPKQSKKNSWNQIHF
SHSQQDLDNHINETFDVPASPEKSTPNGGIPQDNLVLIKMKPDEYGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDITEHTHDQVVMFIKASCERHSGELVLL
VRPNAVYDVVEEKFENEPDFQYIPEKSPLDGVHQNDNALRESMVQLAEGLDSGTILTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKDNDDYINANYINMEIPSSSII
NQYIACQGPLPNTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPELTESSLYGTFQ
VTCHSEEGNSAYVFRNMTLCNLEKNESRQLIQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIIVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFIKPLKT
Download sequence
Identical sequences G3WN40
XP_003763841.1.9362 ENSSHAP00000016845 ENSSHAP00000016845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]