SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017164 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017164
Domain Number 1 Region: 318-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 2 Region: 262-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family EGF-type module 0.043
Further Details:      
 
Domain Number 3 Region: 381-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017164   Gene: ENSSHAG00000014588   Transcript: ENSSHAT00000017307
Sequence length 493
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841559.1:1525387:1529549:-1 gene:ENSSHAG00000014588 transcript:ENSSHAT00000017307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPFSQIPVVSRAMLGQMLWLLLAAWMLAPGLSAGPQVPTDPCYDEAGAPQRCIPEFVN
AALGREVQASSTDPRQTHPAAFLTDASAAADRTCWRSETLTRTPLNVTLTLPLGKAFELV
YVSLHFCSARPDSAAVFKSQDHGRSWSPLRFFSSQCSRVYGRPSRAVGQAPAQASLGSIV
PRGPEALCSEPPPRTGPLLAFSMQDGLPPGQDLDSSPVLQDWVTATDIRVVLTRPVGPRA
TEGGVVAPYVYSVGELQVGGRCKCNGHASRCVADTQGRLVCDCRHGTEGPDCERCKPFYC
DRPWQRATAHEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYC
REGFYRDQTRVLSHRRACKACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQ
SRSPVAPCVKIPAMVPTGVTSTVAPEDCDSHCKPARGSYRINLKKYCGKDYGTKPLRHRV
PFTFTRLDCYSWH
Download sequence
Identical sequences G3WP09
XP_003762170.1.9362 ENSSHAP00000017164 ENSSHAP00000017164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]