SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017924 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017924
Domain Number 1 Region: 305-406
Classification Level Classification E-value
Superfamily ARID-like 3.66e-33
Family ARID domain 0.0004
Further Details:      
 
Domain Number 2 Region: 560-675
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000011
Family Chromo barrel domain 0.012
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000752
Family Tudor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017924   Gene: ENSSHAG00000015214   Transcript: ENSSHAT00000018072
Sequence length 1107
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856802.1:1724511:1895179:1 gene:ENSSHAG00000015214 transcript:ENSSHAT00000018072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAIDEPPYLTVGTDVSAKYRGAFCEAKIKTTKRLVKVKVTFRHDSSTMEVQDDHIKGPL
KVGAIVEVKNPDGAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDEDEDDRKQIDELLGKVVCVD
YISLDKKKALWFPALVVCPDCSDDIAVKKDNILVRSFKDGKFTSVPRKDVHEISSESSPK
PDAVLKQAFDHALEFHKSKTVPNNWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEE
EIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGA
VWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKMVNKPCKEC
ENAKETKNKEEPESEIKAEVKEEGDNILQEEKPAEDEIERKENIKPCLGNKKNLSEPTHT
QSDQEKELNNKKTEENENLEVKEDETIKVDEMLNTKVEAEDEKAKSGDETNKEEDEDEEE
AEEEEEEEEEEEEEEEDDDDDNNEQEEFECYPPGMKVQVRYGRGKNQKMYEASIKDSDVE
GGEVLYLVHYCGWNVRYDEWIKADKIVRPADKNVPKIKHRKKIKNKVDKEKEKDEKYSPK
NCKLRRLSKSPFPANTPPEIASKLDTETKNSEQLQVKSVEITSILNGLQASESSAEDSEQ
EDEARTQDIDNNGKEESKADTVSHDKNELSPKEEQSSLSVPQENRIPTDSLISKSISKSP
ERLRKDLEDISEDTDYEDEVTIKRKEIKKETTDKASKPQVKRGKRRHCNTEECLKPGSPS
RKEEKSKSKESLCLENSSNSSSDDDEDKSKAKVTPTKKYNGLEDKRKNLRTTGFYSGFSE
VAEKRIKLLNNSDERLQNSRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHASS
EDVATEEQLQTVAEEENGSLGIELEKPLPVNLDIKPVEEKNIEVNDKKSEFPSSGSNSVL
NTPPTTPESPSSVTVTETSRQQSTVTVSETLAPNQEEALMLVSAPAVVINQNWNILEKSV
QVRKELKMLRGEEVHQKSRKEATKHQW
Download sequence
Identical sequences G3WR69
XP_012403407.1.9362 XP_012403408.1.9362 ENSSHAP00000017924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]