SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017968 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017968
Domain Number 1 Region: 218-310
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.31e-19
Family Tudor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 5-59
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000692
Family Tudor domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017968   Gene: ENSSHAG00000015254   Transcript: ENSSHAT00000018116
Sequence length 381
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841299.1:1732901:1743911:1 gene:ENSSHAG00000015254 transcript:ENSSHAT00000018116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSFQITNVHSSRALDVQFLDSGTVTSVKVSELREIPPRFLQELIAIPPQAIKCCLADLP
LSIGMWTPDAVLWLRDTVLNCSDCSIKVMKLDEPKGIAHIYLFTPKNFPDPHRSINRQIT
NADLWKHQKDVFLSAAPCEVTPPNNKSDSVTLPRTTLESVKKNFIDTIPRSLIEHATNLS
IMELPPPIPLSKPGEHMDVYVPVACHPGHFVIQPWQELHKLEVLMEEMILYYSVSEERPV
TVEKDKVYAAKVENKWHRVLLKGILTNGLVSVYELDYGKHELVSIRKVQPLVDVFRKLPF
QAITAQLAGVRCSQWSEEASIVFRNHVEKKPLVALVQAVVESTNPWDRKIVAYLVDTSLP
DTDIWIHDFMSEYLVELSKIN
Download sequence
Identical sequences G3WRB3
ENSSHAP00000017968 ENSSHAP00000017968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]