SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018333 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018333
Domain Number 1 Region: 116-500
Classification Level Classification E-value
Superfamily Serpins 3.67e-88
Family Serpins 0.00000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018333   Gene: ENSSHAG00000015561   Transcript: ENSSHAT00000018483
Sequence length 502
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864900.1:1839079:1852694:1 gene:ENSSHAG00000015561 transcript:ENSSHAT00000018483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARLTPLLTLLLLFLAARADGQADLWSPVSSRTQSSPSGLQSLGYLKVDHGSREEQTTK
NETLLAQKVVKDKNPHPPTDSPTESATEPTTQSPTELPTQSPTELSTQPTSQPTTQAPPE
PTCLIPDTSCSEMKTQEAESMLGAALTDFSLRLYRTFSEVKKIDSNMVFSPFSIASLLTN
ILLGAGNTTKRNLEDVLSYPKDFDCVHQTLKNLSTSGFISTSQIFHSPDLILKKDFVNAS
QALYGNQPTVLSNDSEVNLALINSWVANRTNNKIVNLLKSLPSDIRLVLVNTIYLNAKWK
MTFDPKKTYLENFYPKSTKVKVKVPMMRSEKYPVTHFTDPNLKARIGLLQLSDDLSLVIL
LPQHLGVQLAEVELRLSSPVFSAILEKLEKSKSQATLVTMPRLKVNTSQDLLQILEKMEF
FDFSYDLNLCGLTDDPEIQVSTAHHQTMLELNEAGVEASAASTVSVARTMSIFEVRQPFI
FVLWHQKYKFPIFMGRVYDPNS
Download sequence
Identical sequences G3WSC8
ENSSHAP00000018333 ENSSHAP00000018333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]