SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018563 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018563
Domain Number 1 Region: 107-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000577
Family EGF-type module 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018563   Gene: ENSSHAG00000015758   Transcript: ENSSHAT00000018717
Sequence length 210
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834595.1:1906255:1921560:-1 gene:ENSSHAG00000015758 transcript:ENSSHAT00000018717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPSLVLKLLLAAVLSALVSGESLERVQSRLSENQGTEKENPDSSTGSSSQLLHSRVSR
TEVLDLQADERDLVRVAFSSKPQALVTPSKEENGKKRRKGKGMGRKRDPCLRKYKDYCIH
GACKYVKELRMPSCICQTGYHGERCHGLSLPVENPLYGYDHTTILAVVAVVLSSVCLLII
AGLLMFRYHKRGVYDVESEEKVKLGTPIAH
Download sequence
Identical sequences G3WT08
ENSSHAP00000018563 ENSSHAP00000018563 XP_003756676.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]