SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018755 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018755
Domain Number 1 Region: 66-134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 123-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000187
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 3 Region: 224-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000233
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018755   Gene: ENSSHAG00000015919   Transcript: ENSSHAT00000018910
Sequence length 426
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834717.1:1997588:2027332:1 gene:ENSSHAG00000015919 transcript:ENSSHAT00000018910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIVIPGKSILQNCLNKQQLLSAIRQMQQLLKGQETRFTEGIRNMKNRLTMLQNSVNKAL
PDVPAVSCPALEAPHNGRKFGSKYLVDHEVHFTCNPGFQLIGHSSLLCQSNGNWTGDKPE
CKDISECASHPCQNGGTCVEGVNQYKCTCPQGWNGNNCQHQAQTAAPEWSVTNDPAFSRK
PRCAKVDRTQHCSCEAGFHMKGTADNSICQDVNECEVYKLEGANQLCMHNCINTPGSFRC
SCPTGYRTLEDGKSCEDIDECADSQNTCTRGTTCINTGGSFQCVNPECPKSSGNVSYVKT
SSFQCERNPCPMDSKSCHHAPKTISFHYLALPSSLKTPITLFRMATASAPGRPGPDSLRF
GIVGGNSRGHFVMQRSDRQTGELILVQSLKGPQTLEVDVDMSEYLDRTFQANHLSKITVF
VSPYDF
Download sequence
Identical sequences G3WTK0
ENSSHAP00000018755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]