SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000018815 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000018815
Domain Number 1 Region: 1758-2004
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.58e-52
Family Ankyrin repeat 0.0000000497
Further Details:      
 
Domain Number 2 Region: 1086-1221
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000636
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 543-674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 361-485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 886-1016
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 770-903
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000942
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 706-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000958
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 8 Region: 481-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000982
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 9 Region: 93-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000243
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 240-368
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 209-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.021
Further Details:      
 
Domain Number 12 Region: 130-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 13 Region: 13-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.028
Further Details:      
 
Domain Number 14 Region: 1216-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000464
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 15 Region: 669-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000482
Family EGF-type module 0.017
Further Details:      
 
Domain Number 16 Region: 1360-1392
Classification Level Classification E-value
Superfamily Notch domain 0.0000000863
Family Notch domain 0.0011
Further Details:      
 
Domain Number 17 Region: 1013-1056
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.04
Further Details:      
 
Domain Number 18 Region: 1257-1297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.02
Further Details:      
 
Domain Number 19 Region: 1439-1470
Classification Level Classification E-value
Superfamily Notch domain 0.000000301
Family Notch domain 0.0032
Further Details:      
 
Domain Number 20 Region: 59-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000547
Family EGF-type module 0.017
Further Details:      
 
Domain Number 21 Region: 172-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000623
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000018815   Gene: ENSSHAG00000015968   Transcript: ENSSHAT00000018970
Sequence length 2406
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856995.1:1972650:2093378:-1 gene:ENSSHAG00000015968 transcript:ENSSHAT00000018970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPEGFLGEYCQQLDPCERTKCQNGGTCVPLALQGKATCRCAPGFTGEDCQYSTSHLCFVS
RPCQHGGTCQMRSRDTYECICPPGRTGKHCQWVDACLSQPCANGSTCTTIANQFSCSCPA
GFTGQKCDTDLNECDVPGRCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCSPSPCVN
GGTCRQTDDFTFECNCLPAGFEGTTCERNIDDCPNHNCKNGGVCVDGVNTYNCRCPPQWT
GQFCTEDVDECQLQPNACQNGGTCTNHNGGYGCVCVNGWSGDDCSENIDDCAFAACTLGS
TCIDRVASFSCTCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGAA
CTDDVDECALTNSNPCEHAGKCVNTEGAFHCECLKGYTGPRCEMDINECHSDPCQNDATC
LDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGHCLDKVNRFQCVCPPGFTGSVCQI
DIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGLLCEENIDNCDPDPCHHGQCQDGIDSY
TCICNAGYMGAICSEQIDECLSSPCLNEGRCIDLVNGYQCNCQPGTSGVNCEINFDDCAS
NPCVHGICMDGINRYSCVCLSGFTGQRCNVDIDECASNPCRKGATCINDVNGFRCICPEG
PHHPSCYSQVNECLSNPCIHGNCTGVANGYKCLCEAGWVGINCEVDKNECLSNPCQNGGT
CDNLVNGYRCTCKQGFKGYNCQINIDECASNPCLNQGTCTDDISGYTCHCMLPYTGKNCQ
MVLAPCNPNPCENAAICQESANFESYTCLCAPGWQGPRCNVDIDECVSKPCMNRGVCHNT
EGSYLCKCLPGFTGVDCEEDIDECLANPCQNGATCVDGVNSFSCLCLPGFNGDRCQTDMN
ECLSEPCKNGGTCSDYVNSYTCRCQAGFDGPHCENNIDECTESSCFNGGTCVDGTNSFSC
LCPVGFTGPFCLHEINECNSHPCLNEGTCIDGVGTYRCNCPLGYTGKNCQTLVNLCSRSP
CKNKGTCIQRKAESQCLCPSEWTGAYCDVPNVSCEVAASRRRVSVDRLCEHSGTCIDAGN
THHCQCPLGYTGSYCEKQLDECASNPCQHGATCRDYVGGYRCECVPGYQGVNCEYEVDEC
QYQPCQNGGTCIDLVNHFKCSCPPGTRGLRCEENIDDCAPDAGGPHCLNGGQCVDKIGGY
TCRCLPGFAGERCEGDINECLSNPCNPEGSLDCIQLINNYSCICRSTFTGRHCETFVDVC
PQMPCLNGGVCAVASNTPSGFICHCPPGFSGARCQSTCGHMKCKKGEQCVHTTLGPRCFC
PRPEDCETGCASSPCQHGGSCSPQKKPPYXAGPTNSPPPACLSQHCAEKARDGVCDEDCN
SHACQWDGGDCSLTMEDPWANCSSPLPCWDYINHQCDELCNTAECLFDNFECQGSSKTCK
YDKYCADHFSDNHCDQGCNSEECGWDGLDCATDQPENLAEGTLVIVVLLPPEQLLQDAHS
FLRSLGTLLHTNLRIKRDAQGALMVFPYYGEKSPANLNRKSTINRRSLPDEQEREVAGSR
VFLEIDNRQCVQASDQCFKNTDAAAALLASHAIQGTLSYPLVSVLSESLDPKPTQLLYLL
AVAIVIVLLVILLGVIMAKRKRKHGSLWLPEGFILRRDSNNHTRREPVGQDAMGLKSLSV
QVSEGNLIDSSTNEHWADDGAPQPKRSKAEDQALLSEEGDPIDRRQWTQQHLEAADIRRT
PSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSEDDEEADDSSANIITDL
VYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADA
QGVFQILIRNRVTDLDARMHDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALH
WAAAVNNVEATLVLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHM
DRLPRDVARDRMHHDIVRLLNEYNVAHSPPGAMLTSALSPVICGANRSFLNLKHTPAGKK
PRRPHAKGAVPTSLPNLAKEAKDSKGGRRKKSLSDKGQLSESSVTLSPVDSLESPHTYVS
DTTSSPMITSPGLLQASPSPMLAPAAPVHAQHAVSFSNLHEMQALPHGANPVLPSVSQLL
PHHHLAPAGAGSGSGRLHPVAVQADWMSRMEINESQYNEMFGMVLAPAEGAHSVLAPPNR
PGQPEGKHVAPSREPLPPIMTFQLIPKGGIAQPAGAAQPPACPPAVAGPLPTMYQIPDMA
RLPSVAFPTGMMPQQDGQAVQTVLPPYHPFPSSVGKYPTPPSQHSYASSTAAERTPSHSG
HLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGSGGGQRGPGAHMAEPPPRT
NMQVYA
Download sequence
Identical sequences G3WTR0
ENSSHAP00000018815 ENSSHAP00000018815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]