SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019389 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019389
Domain Number 1 Region: 315-525
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-58
Family Eukaryotic proteases 0.00031
Further Details:      
 
Domain Number 2 Region: 147-256
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-34
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 3 Region: 47-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 86-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000541
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019389   Gene: ENSSHAG00000016467   Transcript: ENSSHAT00000019546
Sequence length 531
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834463.1:2183664:2208180:-1 gene:ENSSHAG00000016467 transcript:ENSSHAT00000019546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLILSPDVDWTPYDYEYSAEYYDHEINNISDYEEYIDWTFIENDTTDLCQPNPCMHGGD
CVINGDNFKCNCPAPFTGGKCQAVRNACRKNPCVRGECLIIQTPPYYKCACNHPYGNPHC
SKVFTACRPNPCKNGGICKRNRRRSKFTCSCPDGFRGKFCEIGGPEDCYEDKGLNYRGKV
SKTINHNTCLHWNSHLLLREAYNVFMEDAELHGIGEHNYCRNPDGDKSPWCFIQLDKRTL
SWEFCDVTSCSSSETRSNLVSVDQGWTEAATPKGRGKIGTEKYQARPIYFNKESFVGEET
YPCQEVINLLLNDNIFRAFYVSSLLIKRFWLLTSFPSFLLKAKQIRVVLGVQDLLKSESH
EQSFRVEKIFVHPDYQEEDDIPYNDIALLKLKAVKGQCAQESKYVKTACLSEVPFPSQTE
CYISGWGETSTGRGSRYLLDAKVQLISKSHCNAPNQYNNLIDETMFCAGGQGIDSCQGDS
GGPLTCERDGKYYLYGIVSWGFKCGKKPGVYTLVTKYHNWIKDTIQEESGS
Download sequence
Identical sequences G3WVD4
ENSSHAP00000019389 ENSSHAP00000019389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]