SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019415 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019415
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000353
Family Hairy Orange domain 0.00012
Further Details:      
 
Domain Number 2 Region: 46-106
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000929
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019415   Gene: ENSSHAG00000016487   Transcript: ENSSHAT00000019572
Sequence length 340
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856947.1:2194366:2209776:1 gene:ENSSHAG00000016487 transcript:ENSSHAT00000019572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSDSDMDETIDVGSENNYSGQSTGSVIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKSYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDTSDPLRVRLVSHLSTCASQREAAAMTSSMAHHHHHP
LHPHHWTAAFHHLPTALLQQNGLHASETTPCRLSTASEVPPPSHGSALLTATFAHADSAL
RMPSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAAV
AAATAISPPLSVSATSSPQQTGSGTNSKPYRPWGTEVGAF
Download sequence
Identical sequences G3WVG0
XP_003769461.1.9362 ENSSHAP00000019415 ENSSHAP00000019415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]