SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019647 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019647
Domain Number 1 Region: 669-896
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-58
Family DBL homology domain (DH-domain) 0.00000000146
Further Details:      
 
Domain Number 2 Region: 275-451
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.64e-53
Family Regulator of G-protein signaling, RGS 0.000000071
Further Details:      
 
Domain Number 3 Region: 900-1034
Classification Level Classification E-value
Superfamily PH domain-like 7.82e-42
Family Pleckstrin-homology domain (PH domain) 0.000000384
Further Details:      
 
Domain Number 4 Region: 2-43
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000486
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019647   Gene: ENSSHAG00000016682   Transcript: ENSSHAT00000019804
Sequence length 1479
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856822.1:2288582:2363458:-1 gene:ENSSHAG00000016682 transcript:ENSSHAT00000019804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSTSSVGVSGLQEDPGS
LGPSRVIPVVPPPPPPPPPPLPQRITGPKPLQDPEVQKHANQILINMLRQEEKELQHFQE
MYSRNPASSLLEEQIEGARRRITQLQRKIQQETGVSVDILQLYDTNPANLKSSEGCHFLD
SQDGDSGLDSGTERFPSLSESLLKRNSVLSDPGLDSPRTSPVIMAKMPQHHRRQGSDTTV
LPTTEQSLDHSAKPLIIGPEEDYDPGYFNNECDILFQDLEKLKYRPAHLGVFLRYIFSQA
DPNPLLFYLCAEVYLQTYPKDSRGLGKAIWAIFLEKNSPLRVKIPETLQAEIDLRLRNNE
DIRSALSEAQEATMPEIQEQIQDYRTKRTMGLGSLYGENDLLDLDGDPQRERQIAERQLA
ALGDILSKYEEDRSVSMDFALNTYMSHAGIRLRETRPSTAEKSQTLPDKDKWLPFFPKTK
KQSSNTKKEKEALEDKKRNPILKYIGKPKSSSQNIKPGNVRNIIQHFENNQQHESPEPGL
QRLSTGSFPEDLLESESSRSEIRLGRSESLKGREEMKKSRKAENVPRSRSDVDMDAAAEA
TRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPSLGYCTDALLPHLLEDDLGQLS
DLEPEPDAQNWQHTVGKDVIAGLSQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMK
KENLMPREELARLFPNLPELIEIHNSWCEAMKKLREEGPVINEISDLMLARFDGPAREEL
QQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESNPQCRRLQLKDLIVSEMQRLTKY
PLLLENIIKYTDDSSSEYHKLCRARDQCREILKYVNEAVKQTENRHRLESYQKRLDTTSL
ERASNPLAAEFKSLDLTTRRMIHEGPLTWRISKDKTVDLHVLLLEDLLVLLQKQDEKLLL
KCHSKTSLGSSDNKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVALTSL
DKNMWMELLEDAVQNATRNPSIVPNPSHLSQPVPQQPSQHSSSSTSMGLTDSEASQGNGC
QSEDELLPKGDRSQQWVNGKHQALLEEPEQEGSEEELVAPTSTSSLGGGGLGIRTRGAIH
LPLPSPLFMEGLADSALEDVENLRHLILWSLLPGHPIESRATVEPEDDLTPTPSVIGITS
HPWDPGSPGQLPGEMEGNDLAPSGQMSSQLELETGELDDAALSSLEHLPPRARNSGIWEH
PELDRDVPEEPLTTEAIGGYKVVRKAEVAGSNAVPALPECGKSESEPPEAGGGPNAAGNC
FYVSMPTGPPESNTDPSDTARSFSQHEAPCASPPEPEHRGGGGDEGRARGTASSLALRDV
GTIFRTIEQLTLKLHRLKDMETAHRELLKSLGAESSGGTTPVGGLSAEAVRWTESSPSPP
AKEPFSSCSKDSHEQGLGPETGSDSLEESPADTAISLGL
Download sequence
Identical sequences G3WW42
ENSSHAP00000019647 ENSSHAP00000019647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]