SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019669 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019669
Domain Number 1 Region: 317-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 2 Region: 119-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 3 Region: 218-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000879
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 171-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000232
Family Laminin-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019669   Gene: ENSSHAG00000016698   Transcript: ENSSHAT00000019826
Sequence length 519
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834635.1:2294949:2392067:-1 gene:ENSSHAG00000016698 transcript:ENSSHAT00000019826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXXXXXASAATSPAAQETPEPEPEPTPRSTEAAPTGPGSPLTTAPHV
LTPTPTPTLILTTTTQTVAATQTATLTLTPSVLWSSPSPTPPASQPGQLASPTPREHICN
CSIVGSLDGNRCNQTTGQCECLPGYKGLHCDSCEESFYPAGTSVQGLCLSCGCNLHGATS
LICSSSGKCQCKIGVGGSKCDRCQDGYYGFSENGCLPCQCNNQSVTCDAFSGTCLNCQGN
SRGDHCEGCKNGFYKSPTAFHKCLRCPCSAVTSTGSCFIHSGELVPKCDQCKEGYTGPNC
NVCENGYYNSDSICVKCECGGHVDSNKTPKICKPESGECIDCLHNTTGFHCENCWEGYVR
DLKGNCIKKEIVVTTTEGSTTLVSNATLSTSSPTTVTNSTFTPTTLQPIFSIGSSENSTS
ALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYTYREYQNRKLNAPFWTIELKEDNISFS
SYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences G3WW64
ENSSHAP00000019669 ENSSHAP00000019669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]