SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019679 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019679
Domain Number 1 Region: 54-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000238
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019679   Gene: ENSSHAG00000016706   Transcript: ENSSHAT00000019836
Sequence length 147
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864738.1:2301390:2311002:1 gene:ENSSHAG00000016706 transcript:ENSSHAT00000019836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGIPLYILLNAMVSLSKEAAVTVTTPITSQQSNWTVNKTEAEYTEGPIALKFSHPCLA
DHHSYCINGVCAFHHELRKAICRCTTGYTGERCEHLTLTSYAVDSYEKYIAVGIGVGLLL
SLFLAIIYCYVRKRYGSRRNMAWTALH
Download sequence
Identical sequences G3WW74
ENSSHAP00000019679 XP_003772888.1.9362 ENSSHAP00000019679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]