SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019872 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019872
Domain Number 1 Region: 182-305
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 5.49e-61
Family Dystroglycan, domain 2 0.000000434
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily Cadherin-like 6.43e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 63-160
Classification Level Classification E-value
Superfamily Cadherin-like 2.2e-16
Family Dystroglycan, N-terminal domain 0.00000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019872   Gene: ENSSHAG00000016867   Transcript: ENSSHAT00000020029
Sequence length 880
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841583.1:2387060:2414743:1 gene:ENSSHAG00000016867 transcript:ENSSHAT00000020029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMTVGFVLLSPLWGRTFFILLMIASAQSHWPSEPSEVVRDWENQLEASMHSVLSDLRET
IPAVVGIPDGIAVVGRSFRVAIPTDLIASNGEIIKMSEAGKEVLPSWLHWDPESRMLEGL
PLDTDKGVHYISVNAMHLAANGSYVPQAMNVFSIEVYPEDHSEPQSVRVASQDVNEAAPF
VCGADEPVTILTVILDADLTKMTPKQRVELLNRMKSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPNISNVETPAKEGTMSAQLGYPVVGWHIA
NKKPHFPKRIRRQINATPTPVTAIGPPTTALQEPPSRIVPTPTSPAIAPPTETAAPPVRD
PIPGKPAVTIRTRGAIVQTPTLGPIQPTRVSDTGTTVPGQIRPTTVPGYIEPTAVITPPT
TTTKKPRITTLKPATPSTTDSSTATTRRPTKKPRTSRPVPRVTTKAPLTRLETASQPTRT
RTTTSGTTRGGEPNKPPALKNHIDRVDAWVGTYFEVKIPLDTFYDEEDTTTDKLKLTLKL
REQQMVGEKSWVQFNSNSQLMYGLPDSSHLGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDRSPAKFKAKFTGDPASVVNDIHRKITLVKKLALAFGDRNSSTITLQNITKGSIVVEWT
NNTLPLDPCPKEQIRGLSRRISEDDGKPRPVFSNTLEPDFKAVSISVTGSGSCRHAPPTV
VTEKDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGKLTIEDQATFIKKG
VPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQNMPETTPLNQDTIGEYTPLRD
EDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences G3WWR7
ENSSHAP00000019872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]