SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019907 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019907
Domain Number 1 Region: 45-155
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.14e-34
Family MBT repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 405-510
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.9e-30
Family MBT repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 289-396
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.15e-29
Family MBT repeat 0.00086
Further Details:      
 
Domain Number 4 Region: 181-296
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.41e-27
Family MBT repeat 0.000000845
Further Details:      
 
Domain Number 5 Region: 817-889
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.47e-17
Family SAM (sterile alpha motif) domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019907   Gene: ENSSHAG00000016894   Transcript: ENSSHAT00000020064
Sequence length 894
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861623.1:2399886:2644907:-1 gene:ENSSHAG00000016894 transcript:ENSSHAT00000020064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRVSLVSNMQETSHLSLEKCNSPANGNNEYDSDEGSSMEDPDFNWGEYLEETGAVAAP
HTSFKHVEISLQSSFQPGMKLEVANKNNPDTYWVATIITTCGQLLLLRYCGYGEDRKADF
WCDVMTAELHPVGWCTQNNKVLMPPDAIKEKYTDWTDFLIHDLTGSRTAPANLLEGPLRG
KNPVDLITVDSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEETESYDQWLFYLDYR
LRPVGWCQENKYRMDPPSEIYSLKTTSEWKCALEKSLNDAAKFPLPMEVFKDHADLRSHF
FTVGMKLEAVDMSEPFNICPASVTKVFNNHYLQVTIDDLRPEAKKISMLCHADSLGILPV
QWCLKNGVNLTPPKGYAGQDFDWADYQKQHGAEAAPHFCFRNTSFSRGFTKNMKLEVVNP
RNPGELCVASVVSVKGKLMWLHLEGLQSPVPEYIVDVESMDIFPVGWCEANAYPLTPPHK
AVLQKKRKIAVVQPEKQLPSTVPVEKIPHDLFSFPQPDTTGTVNGKYCCPQLFINHRCFS
GPYLNKGRIAELPQSVGPGKCVLVLKEVLSMVINAAYKPGRVLRELQLVEDPQWNFQEET
LKAKYRGKTYRAVVKIVRTSDQVADFCKRVCAKLECCPNLFSPVLVTEICPENCSIHTKT
KYTYYYGKRRKIIKPPIGENSTEIGPPKPTRRRKRRKSIFVQKKRRSSTVDFTTGSAEES
EEEDADAMEEDTGSEETSSELRDDQTDTSSADVPSARPRRAVTLRSSTELDRPPPVERTR
RSRKAQTFSCAEGDKCPQAKPDRAEEVKHEEEEKLVLESNPLEWTVTDVVRFIKLTDCAP
LAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN
Download sequence
Identical sequences G3WWV2
ENSSHAP00000019907 XP_003771452.1.9362 ENSSHAP00000019907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]