SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019912 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019912
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000101
Family EGF-type module 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019912   Gene: ENSSHAG00000016899   Transcript: ENSSHAT00000020069
Sequence length 165
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864738.1:2401811:2428403:1 gene:ENSSHAG00000016899 transcript:ENSSHAT00000020069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSYFWKISTVLLTIGMSLLQNAHSTTVIPTCIPEESNDNCTALVQIENNPPVGPVAIAK
CGEDMQGFCFHGQCIYLVDMSQHVCRCEVGYTGSRCEHFLLTVHQPLSKEYVVLTVMLVI
LFLIIIVGGTYYFLRWYKNRKSKESKKEYERVTLNDEKNSTFLQV
Download sequence
Identical sequences G3WWV7
ENSSHAP00000019912 ENSSHAP00000019912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]