SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000019950 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000019950
Domain Number 1 Region: 793-846
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000151
Family Laminin-type module 0.00029
Further Details:      
 
Domain Number 2 Region: 250-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000184
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 3 Region: 849-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 4 Region: 900-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 690-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 6 Region: 362-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 409-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 306-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000019950   Gene: ENSSHAG00000016927   Transcript: ENSSHAT00000020107
Sequence length 1558
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834652.1:2413152:2498757:1 gene:ENSSHAG00000016927 transcript:ENSSHAT00000020107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDACYDERGRPQRCLPVFENAAFGRQAQVTNTCGSPPEEYCLQMGAPGDTQLCHRCDARH
PDHSHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSVNITLQLGKAYEITYVRLKFHTSR
PESFAIYKRSWAGGPWVPYQYYSASCEKTYGKREDQYLRPGEDERVAFCTDEFSDISPLS
GGNVAFSTLEGRPSAYSFDESPILQEWVTSTDLLISLNRLNTFGDDIFKDPKVLQSYYYA
ITDFSVGGRCKCNGHASECVLDEGGQLVCSCQHNTTGTDCERCLPFYQDRPWARGTAEAA
NECLPCNCSGLSEECFYDWELYRSTGRGGHCRNCRDHTAGPHCEYCQENFYRWDQQQPCQ
PCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDRCLTGFHSLSEGGCRACACNGAGSLGPC
DSRNGRCPCKDKVEGYLCDRCQPGTFNLQPHNPSGCTSCFCYGHSMVCAASTHYGIRYII
SEFHQGAEGWQIRGPGGREKPAQWSQRGIFLEPKGEELWDFVAPEKFLGDQRFSYGQSLS
LTFWVPPGGSLLPVRLKLEGAGLTLFLKPSSPTASQQPGRPEEYLLVFSLQETSEDTNLP
LPAFHFQRLLANLTGLQIEITGPGGRHSTGQMILTEVQLTSAGPGLSPLAPWVEECTCPE
GYMGQFCESCSLGYKRETPLGGPYASCVPCTCNQHGTCDPETGICQCLHHTEGPYCERCT
SGFYGNPFLGHVDDCKPCPCPGQSACTTIPESGEVVCTHCPKGQRGRLCEICDDGFFGDP
LGRSGPRQPCQRCQCNGNVDPNAVGNCNPTTGHCLRCLYNTTGAHCEQCQEGFYGSALAP
HPLDKCTPCSCNSSGSTREQGACDPRTGQCSCLPHVTGRDCSHCSPGFYDLQPERGCRSC
KCHPVGSQENQCHPVTGQCPCLPGVSGVACTHCQPDFFGFSAKGCRACNCSPLGSVTTQC
HENSTCVCKPGFVGYKCDHCKENFFLTAEGSQCQECPICFSLVKKEATKLKATLTMMEQW
LRKSDCDSPWSNYILLGESTRGDAYQGSYLLQGTREAFLEQMEELESSMRAARHQLRAAS
ESVNCAKNSLEKTCIQLEDIEALLLSTEQEVQQASGALRTMVSLVKGSKVPHQLTNWSHL
ASESQALAKSHRDIATKIEAAAQRALLASNTSYTLLWSLVEGTDAQKIQRELEDKYQEVQ
RAQEELRTSTAQAVKEAKSVLTSVQHVSSERARHLAKLSTPEILPLTHLARDLDRKLQDL
EKTVASREQVFTRAAQDLLATSQGEFQKIQPFQQLHDGADAALSLATSSIAKTRVTVRDS
KTLLTDLEEMRKTFPQPKDQASLRRKARIIQDKLIGDTQKKTKQAERMLGNAASVSATAK
KKAKEAELLAKESTKHSKALLRESKQQYRQAVKLANQAQGALRDISRQVMVSKDRRKEME
KIEWVGTGLNKVERSIREARISLEMDIKTLSILLTRLGKLDPYQALASALNETEQKLEPL
RQRLDGQGPLQDKLSLLEQEAEQQELQIQDLESDLKEIQADKQNLEDILHSLPEGCAS
Download sequence
Identical sequences G3WWZ5
ENSSHAP00000019950 ENSSHAP00000019950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]