SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020234 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020234
Domain Number 1 Region: 126-219
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-18
Family Voltage-gated potassium channels 0.0047
Further Details:      
 
Domain Number 2 Region: 48-97
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000173
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020234   Gene: ENSSHAG00000017163   Transcript: ENSSHAT00000020394
Sequence length 339
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834527.1:2543362:2569810:-1 gene:ENSSHAG00000017163 transcript:ENSSHAT00000020394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTQAETRASGSHTFAIKIFCLTQETRARPEESVSTVGNSSSLCPRQGFGMTAPATVEGK
VFLIFYGLIGCSGTILFFNLFLERLITVITYVMRLFQETQIRKRELLPADKLRTSGISEQ
ENTGPWKPSVYYVMLILCVASLIISCCASAMYTPVEGWTYFDSFYFCFVAFSTIGFGDLV
SSQNAQYSSQELYRFGNFVFILLGVCCIYSLFNVISILIKQFINWMVWEIEFYFFRCQRK
ALFFRRNAVTPSIMRNGQEISIETDGVIESETDEHRPPGETASVKDFKGSLATPQKPPSE
AANGGPRKPPGTALHTGFSGGVGALGIMNNRLVETSGKR
Download sequence
Identical sequences G3WXS9
ENSSHAP00000020234 ENSSHAP00000020234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]