SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020702 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020702
Domain Number 1 Region: 247-356
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.54e-45
Family MBT repeat 0.00000071
Further Details:      
 
Domain Number 2 Region: 356-473
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.9e-42
Family MBT repeat 0.0000428
Further Details:      
 
Domain Number 3 Region: 440-537
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.15e-38
Family MBT repeat 0.0000143
Further Details:      
 
Domain Number 4 Region: 751-818
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000229
Family SAM (sterile alpha motif) domain 0.002
Further Details:      
 
Domain Number 5 Region: 549-591
Classification Level Classification E-value
Superfamily CCHHC domain 0.000000183
Family CCHHC domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020702   Gene: ENSSHAG00000017557   Transcript: ENSSHAT00000020868
Sequence length 828
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856948.1:2804353:2928562:1 gene:ENSSHAG00000017557 transcript:ENSSHAT00000020868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEPASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDETEIESVKKATA
TTTWMVPTAQEVFSEKTGVPFRLKETMKVEGLQFCENCYQYGTVDEFLSGGKFCSQKCAR
QNKDNREQKEEKDVGEDNEEDDSKCSRKRKAKLPLRAEPKEDGEEREDENRYSFSSEDCF
SRIPEILENKHDGRILRGSQRARRKRRNDSAVLKQNLPPKGKKAWCWASYLEEEKAIAVP
TKLFKEYQSFPYNKNGFKVGMKLEGVDPEHQSMYCVLTVAEVCGYRIRLHFDGYPDCYDF
WVNADALDIHPVGWCEKTGHKLHPPKGYKEEDFNWQTYLKTCKAQAAPKSLFENQNTTVI
PSGFRVGMKLEAVDKKNPAFICVATVTDMVDNRFLVHFDNWDESYDYWCEAASPHIHPVG
WCKEHRRTLITPPDYPNVKHFSWDKYLEETNSLPAPARAFKVKPAHGFQKKMKFEIVDKR
NPVFIRVATVADTDEHRIKVHFDGWSNSYDYWIEADSPDIHPVGWCAKTGHPLQPPLSPL
ELVEASEQGGCPTAGCKGIGHIKRARHPGYHSAINCPYSEINLNKDRILPDRLSGEMSPA
SPSLTRNKKMEINECSSSPEIKKCPSPEHIDSKSLIQNRSSGKSVPERNIQEDMEGKPPY
KKPLLCDDNEKKSSREQQIEDKPIKEECEEGIKSEMRTPNQTKGIGAEPSSQQAQRRSAV
FLSFKSPIPCLPLRWEQQSKLLPTVAGIPASKVSKWSTDEVSEFIQSLPGCEEHGKVFKD
EQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHNEL
Download sequence
Identical sequences G3WZ47
ENSSHAP00000020702 ENSSHAP00000020702 XP_012404786.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]