SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020703 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020703
Domain Number 1 Region: 255-364
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.43e-45
Family MBT repeat 0.00000071
Further Details:      
 
Domain Number 2 Region: 364-481
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.63e-42
Family MBT repeat 0.0000428
Further Details:      
 
Domain Number 3 Region: 448-545
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.39e-38
Family MBT repeat 0.0000143
Further Details:      
 
Domain Number 4 Region: 706-773
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000214
Family SAM (sterile alpha motif) domain 0.002
Further Details:      
 
Domain Number 5 Region: 557-599
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000017
Family CCHHC domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020703   Gene: ENSSHAG00000017557   Transcript: ENSSHAT00000020869
Sequence length 776
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856948.1:2804353:2928562:1 gene:ENSSHAG00000017557 transcript:ENSSHAT00000020869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEPASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDETEIESVKKATA
TTTWMVPTAQEDDLKHDSLNKVFPFMVSQSVAKLLLVFSEKTGVPFRLKETMKVEGLQFC
ENCYQYGTVDEFLSGGKFCSQKCARQNKDNREQKEEKDVGEDNEEDDSKCSRKRKAKLPL
RAEPKEDGEEREDENENKHDGRILRGSQRARRKRRNDSAVLKQNLPPKGKKAWCWASYLE
EEKAIAVPTKLFKEYQSFPYNKNGFKVGMKLEGVDPEHQSMYCVLTVAEVCGYRIRLHFD
GYPDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEDFNWQTYLKTCKAQAAPKSLF
ENQNTTVIPSGFRVGMKLEAVDKKNPAFICVATVTDMVDNRFLVHFDNWDESYDYWCEAA
SPHIHPVGWCKEHRRTLITPPDYPNVKHFSWDKYLEETNSLPAPARAFKVKPAHGFQKKM
KFEIVDKRNPVFIRVATVADTDEHRIKVHFDGWSNSYDYWIEADSPDIHPVGWCAKTGHP
LQPPLSPLELVEASEQGGCPTAGCKGIGHIKRARHPGYHSAINCPYSEINLNKDRILPDR
LSGEMSPASPSLTRNKKMEINECSSSPEIKEQQIEDKPIKEECEEGIKSEMRTPNQTKGI
GAEPSSQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGIPASKVSKWSTDEVSEFI
QSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAE
Download sequence
Identical sequences G3WZ48
ENSSHAP00000020703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]