SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020815 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020815
Domain Number 1 Region: 100-480
Classification Level Classification E-value
Superfamily Serpins 8.64e-59
Family Serpins 0.0000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020815   Gene: ENSSHAG00000017653   Transcript: ENSSHAT00000020982
Sequence length 484
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856806.1:2879024:2888979:-1 gene:ENSSHAG00000017653 transcript:ENSSHAT00000020982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQSRPLSQNPTTMPSFPSKMLLRVTTVLLVWTTLVVSERVYVHPFYLLTYNQSSCDELNE
VKEETLEEQTFTPVPIQAKTSPLDEITLKDQLVSFGQTLDSEDKTRSIEVGLLLNLVGFR
MYKMLREMMTSANGALLLSPFGLFGTLSSFYLGSVDPTASNLQTFLGVSSQDKSCTSKLD
GNKVLSALKAVQSLLLAQEKKGSSSLLLTTMVGLFTSPDLRLQQSFVQGLSPFANAIYSR
SLNLATDPDLAAKKIDMFVGAVTGWTRKTRLTGISSDTTLLFTTYTHFQGAIKGISLLAE
PQVFWINTTTSISVPMLSGTGIFQYGNDISNNFSIIQIPFNENAFILLIKPQDADLEKIE
DFILSQDFSSWKKHLSSRKIHLTLPKLLQESTYDLQKLLTYTKLPKLLGEEAKLSKISSV
NLKVGKVMNTVLFELKESQEEQEKQSPGVPLEVKLDSPFFFAVYEKLSKAYLFLSRVTNP
LTGV
Download sequence
Identical sequences G3WZG0
ENSSHAP00000020815 ENSSHAP00000020815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]