SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000020910 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000020910
Domain Number 1 Region: 13-219
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-23
Family Nuclease 0.026
Further Details:      
 
Domain Number 2 Region: 319-364,414-479
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000314
Family Polyphosphate kinase C-terminal domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000020910   Gene: ENSSHAG00000017730   Transcript: ENSSHAT00000021079
Sequence length 509
Comment pep:known_by_projection scaffold:DEVIL7.0:GL856850.1:2936251:2962679:-1 gene:ENSSHAG00000017730 transcript:ENSSHAT00000021079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPWLLLAPLLSPPVPQVTSPPCCLCPEGVHRFQWIRNLVPEFGVSSSHVKVLSSPAEFF
ELMKGQIKTAKRRVVMASLYLGTGPLEQELVDCIESSLERSLQANFSSDLKVSILLDFTR
GSRGRKNSRTMLLPLLRRFPEQVRVSLFHTPNLRGLLRLLIPERFNETIGLQHIKVYLFD
NSVILSGANLSDSYFTNRQDRYVFLQDCPEIADFFTELVNAVGDVSLQLQGDDSVQMVEG
MVHPYKGDQTAYCEAANKRVMDVINAARTRQQLLHAQTFHSDSLLTQEDAAAAGDRRPAP
DTWIYPLIQMKPFEIKIDEIVTETLLTEAERGAKIYLTTGYFNLTQAYMDLVLGTRAEYH
ILLASPEVNGFFGAKGVAGAIPAAYVHIERQFYSEVCSLGQQERVQLQEYWRSGWTFHAK
GLWLYLAGSTLPCLTLIGSPNFGYRSVHRDLEAQIAIVTENRALQQQLHQEQEQLYRRSG
LVSAATFEQPSRYVKLWVKMVTPLIKNFF
Download sequence
Identical sequences G3WZQ5
ENSSHAP00000020910 ENSSHAP00000020910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]