SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021549 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021549
Domain Number 1 Region: 774-882
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 282-401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.65e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 4-130
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 243-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000128
Family EGF-type module 0.02
Further Details:      
 
Domain Number 5 Region: 173-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000911
Family EGF-type module 0.024
Further Details:      
 
Domain Number 6 Region: 593-690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000116
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 7 Region: 648-770
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000381
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 132-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021549   Gene: ENSSHAG00000018253   Transcript: ENSSHAT00000021723
Sequence length 960
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864880.1:3389384:3480065:-1 gene:ENSSHAG00000018253 transcript:ENSSHAT00000021723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECARGIDDCHVDAICQNTPTSYKCSCKPGYQGEGKQCEDIDECDNEFNGDCVHECFN
IPGNYHCTCYDGFRLAHDGHNCLDVNECLFNNGGCQHTCANTMGSYECQCNEGFFLSDNQ
HTCIHHAEEGLSCLNKDHGCGHLCKETLEGGVTCDCRLGFALAKNQRDCILTCNHGNGGC
QHICVDTDEGPECSCHPKYRLHTDGKSCLEKEESTLELMKNNVTSPIADVDKRVKRRLLM
ETCAVNNGGCDRTCKDTSTGVHCSCPMGFTLQFDGKTCKDIDECQTDNGGCDHFCKNTVG
SFDCSCKKGYKLLTDEKSCQDIDECSFERTCDHTCINHPGTFECACNKGYTLYGFTHCGD
TNECSINNGGCQQTCVNTLGSYECQCPSGHQLHWNKKDCVEVKGFLPGNISPKVSMRCTK
IDGVDKCYLNCPSDVRLFPEDVATVRTSVTFRLNEGKCSLKKAELLSEDLSGIISEKYSS
VKESFHYVNLTCGSGKQVPGAFGRPAPTKEMFISVDFELEANQQEVTASCDLSCVLKKTE
KKLRKVIRTLRKTVHREQFHLRLSGMDFEVAKKFPRVSEHLADPCGLGQEHRKGKCVSCS
VGTYDGRQGQCLLCPNGTYQDEEGQITCKPCPNFEKAGSPKTLGARNMSECGGQCLPGEY
SSNGFSPCQPCPLGTYQPEVGRTSCFPCARSWRGELTTKHPGATTFQDCEAKVQCSPGHF
YNTTTHRCIRCSAGTYQPEFGKNYCISCPGNTTTDFDGSTNVTQCKNRHCGGELGEFTGY
IESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDECGDYLVMRKTSSSNSVTT
YETCQTYERPIAFTSRSKKLWIQFKSNEGNSAKGFQVPYVTYDEDYQELIEDIVRDGRLY
ASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences G3X1J4
ENSSHAP00000021549 ENSSHAP00000021549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]