SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021676 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021676
Domain Number 1 Region: 310-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000219
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 234-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000407
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 3 Region: 78-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000022
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 121-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000411
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 158-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000527
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 274-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000206
Family EGF-type module 0.026
Further Details:      
 
Domain Number 7 Region: 197-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000219
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 43-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000514
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021676   Gene: ENSSHAG00000018355   Transcript: ENSSHAT00000021850
Sequence length 466
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849907.1:3508259:3850474:1 gene:ENSSHAG00000018355 transcript:ENSSHAT00000021850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALGNNYFIGFVNDSVSKCIVALRLTVVVKVSTCVPVDSKSHDVQCTGKGKCTTTPAEA
TFSCDCEDQYVGTFCEEFNACQVQPCQNNGTCIDAIEKHDGNNFTCVCLAGYTGEFCQSM
VDYCILEPCKNGATCISSLSGFSCQCPEDYSGPSCEEKVDPCASLPCQNNGTCYADRAHF
TCSCSAGFTGPTCAQLIDFCALNPCAHGTCRSVGTSYKCLCDPAGYHGLYCEEEDNECLS
VPCQNGATCRDLVNSYECVCLPEYKGTHCELYKDPCANISCLNGGTCDSESLNGTCICLP
GFTGEDCETEINECESNPCHHSGTCIDQTNGYICHCPHNWIGPNCEVHIQWRSGPMAESL
SNMPRHSLYIIIGALCVAFVLMLIILIVGICRISRIEYQGSARPAYEEFYNCRSIDSEFS
SAIASIRHARFGKKSRPTMYDATPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences G3X1X1
ENSSHAP00000021676 ENSSHAP00000021676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]