SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021760 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021760
Domain Number 1 Region: 34-121,151-469
Classification Level Classification E-value
Superfamily Serpins 1.96e-134
Family Serpins 0.000000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021760   Gene: ENSSHAG00000018425   Transcript: ENSSHAT00000021934
Sequence length 469
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841234.1:3580968:3607107:1 gene:ENSSHAG00000018425 transcript:ENSSHAT00000021934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWMSFSITSLLELSWITVLLRRANSIIVDHRTMLLLLCTMFSWFCPLHSATVHAETIMEN
LQAANTKFAFNFFKNLSQNNEYQNVFFSPWSVSSTLGMVYMGAKGNTANQMAKVLEFNKV
GGDEVDIPQMTTCGIMQQIQKKPYPVAIQKIQAENDINSSFKALSDAINQISEKYILESA
NKLFGEKSSRFKEEYLRLCKECYYAEPQSVNFREDANEARKEINSWVETQTKGKIPELLP
EGSVNDETRLVLVNAVYFKGKWKTPFQNKAKRPQPFRVNLTERKPVQIMYLQDKLHIGYI
KELKAQILELPYEGDVSMFILLPDDIADSSTGLELLEREMTYEKINQWIENATMESNDVH
VFLPKFKLEKNYELKSILQSMGMKDAFNISQANFSGMSERNDLFLSEVFHQAAVEVNEEG
TEAAAGTGGVMSGRTGHIGLQFVADHPFLFFIRHNKTNTILFFGRFCSP
Download sequence
Identical sequences G3X255
ENSSHAP00000021760 ENSSHAP00000021760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]