SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021815 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021815
Domain Number 1 Region: 437-566
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 628-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000748
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 790-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000783
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 339-453
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000942
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number 5 Region: 714-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000003
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 6 Region: 752-794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000326
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 296-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000746
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021815   Gene: ENSSHAG00000018470   Transcript: ENSSHAT00000021990
Sequence length 1189
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834723.1:3625068:3662550:1 gene:ENSSHAG00000018470 transcript:ENSSHAT00000021990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPRAPVRTEYSLSLIIALLCLRVKVSSASGQFELEILSMQNLNGELQNGNCCHGSRNP
EDRKCTRDECATYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNNFNLKSNRNSERYRIV
LPFSFAWPRSYTLLVEAWDYSNDTNNPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEY
QIRVTCDEYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSPK
HGSCKNPGECRCQYGWQGQYCDKCIPHPGCVHGTCTEPWQCLCETNWGGQLCDKDLNYCG
THQPCLNGGTCSNTGPDKYQCSCPEGYSGANCEIAEHACLSDPCHNGGSCLETFMGFECR
CLPGWTGPTCTTNIDDCSPNHCGHGGTCQDLVNGFKCICPPQWTGKTCQIDANECEAKPC
VNANSCRNLIGSYYCDCIPGWTGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAG
DHCEKDINECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCY
NRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGP
HGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICGDGWEG
TYCETSKNSISGLFTFIYADNSRRRDTQLHVVGLQTIIKRECYSKFDLFSLIVDINDCSK
NPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCVDGDNWYRCECAP
GFAGPDCRININECQSSPCAFGATCVDEINGYRCICPPGHSGPKCQEVTGRPCITTGRVM
PDGAKWDADCNACQCLNGKVACSKVWCGPRPCLIHSKAHNECPAGQSCVPIQDDQCFVRP
CTGVGECRSSNPQPVKTKCTSDSFYQDNCANITFTFNKEMMSPGLTTEHICSELRNLNIL
KNVSAEYSIYIACEPSPSANNEIHVAISAEDTREDGNPIKEITDKIIDLVSKRDGNSTLI
AAVAEVRVQRRPMKSKTDFLVPLLSSVLTVAWICCLVTAFYWCFRKRRKPSSHTHAASED
STTNNVREQLNQIKNPIEKHGAHTVPIKDYENKNSKIAKIRTHNSEVEEDDMDKHQPKAR
FAKQPAYTLVDRDEKPANSAPAKHPNWASKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences G3X2B0
ENSSHAP00000021815 ENSSHAP00000021815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]