SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021816 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021816
Domain Number 1 Region: 437-566
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000816
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 653-779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 3 Region: 628-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000898
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 4 Region: 339-453
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000628
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number 5 Region: 296-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000783
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 775-835
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000523
Family VWC domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021816   Gene: ENSSHAG00000018470   Transcript: ENSSHAT00000021991
Sequence length 1141
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834723.1:3625068:3662550:1 gene:ENSSHAG00000018470 transcript:ENSSHAT00000021991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPRAPVRTEYSLSLIIALLCLRVKVSSASGQFELEILSMQNLNGELQNGNCCHGSRNP
EDRKCTRDECATYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNNFNLKSNRNSERYRIV
LPFSFAWPRSYTLLVEAWDYSNDTNNPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEY
QIRVTCDEYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSPK
HGSCKNPGECRCQYGWQGQYCDKCIPHPGCVHGTCTEPWQCLCETNWGGQLCDKDLNYCG
THQPCLNGGTCSNTGPDKYQCSCPEGYSGANCEIAEHACLSDPCHNGGSCLETFMGFECR
CLPGWTGPTCTTNIDDCSPNHCGHGGTCQDLVNGFKCICPPQWTGKTCQIDANECEAKPC
VNANSCRNLIGSYYCDCIPGWTGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAG
DHCEKDINECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCY
NRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGP
HGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICGDGWEG
TYCETNINDCSKNPCHNGGTCVVNGDSFTCVCKEGWEGPICTQNTNDCSPHPCYNSGTCV
DGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCICPPGHSGPKCQEV
TGRPCITTGRVMPDGAKWDADCNACQCLNGKVACSKVWCGPRPCLIHSKAHNECPAGQSC
VPIQDDQCFVRPCTGVGECRSSNPQPVKTKCTSDSFYQDNCANITFTFNKEMMSPGLTTE
HICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAEDTREDGNPIKEITDKIID
LVSKRDGNSTLIAAVAEVRVQRRPMKSKTDFLVPLLSSVLTVAWICCLVTAFYWCFRKRR
KPSSHTHAASEDSTTNNVREQLNQIKNPIEKHGAHTVPIKDYENKNSKIAKIRTHNSEVE
EDDMDKHQPKARFAKQPAYTLVDRDEKPANSAPAKHPNWASKQDNRDLESAQSLNRMEYI
V
Download sequence
Identical sequences G3X2B1
ENSSHAP00000021816 XP_003758235.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]