SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021919 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021919
Domain Number 1 Region: 3-228
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-63
Family BAR domain 0.000000398
Further Details:      
 
Domain Number 2 Region: 1628-1704
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-16
Family I set domains 0.023
Further Details:      
 
Domain Number 3 Region: 257-311
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000127
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 4 Region: 1245-1318
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000313
Family I set domains 0.052
Further Details:      
 
Domain Number 5 Region: 1027-1080
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000458
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 1529-1602
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000494
Family I set domains 0.071
Further Details:      
 
Domain Number 7 Region: 738-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000719
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 8 Region: 793-853
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 9 Region: 891-945
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000589
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 10 Region: 394-442
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 11 Region: 1084-1140
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 12 Region: 1797-1864
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000602
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 13 Region: 1136-1201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000746
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 14 Region: 1927-1982
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number 15 Region: 1747-1803
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0065
Further Details:      
 
Domain Number 16 Region: 660-720
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000575
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 17 Region: 969-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021919   Gene: ENSSHAG00000018553   Transcript: ENSSHAT00000022094
Sequence length 2019
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834466.1:3730126:4357092:1 gene:ENSSHAG00000018553 transcript:ENSSHAT00000022094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLISEKVSGVEKTKLDEEFLEMQRKIEITSKAIVELLAKCTECLQPNPAYRVKLGMWN
TMSRLKGQVLTSGYPQPEGLLGESMLRYGTELGENSMFGQALLDFGESMKLLAEVKNSLD
INVKQNFIEPLQLLQEKDLKEVGYHLKKLEGRRLDYDYKRRVSRISDEELQNAIGKFEES
KDLARKGMNNLLENDIEQVSQLAVFVEAMLDYHRQSVEILLELHRKLQHRIRISSIFSNY
TYNPSTPISTSKAGRHENFPHSSIKKGPSIHMDRPCCRALYDFVPENEGELGFKEGDIIT
LTHQIDENWQKSSLLRSGAMILPKIFWWLGIWIAIIFCTVLQARAEKSTGAYFLPEFALS
PQGSFLEDTTGEQFLTYRYDDQTSRITRSDEDKDGGWDAWGEWSDCSRTCGGGASYSLRR
CLNGRSCEGQNIRYKTCSNNDCPSDAGDFRAQQCSAYNDVQYQGHYYEWLPIYDDSAAPC
ALKCQARGQNLVVELAPKVLDGTRCNIDSLDMCISGICQAIGCDRQLGSNAKEDNCGVCA
GDGATCRLVRGQSKSHVSPEKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEH
SFAAPGVFVIENTTVEFLRGSDRETFKIPGPLGADFIFKTRYTTSRDSVVQFFFYQPISH
QWRQTDFFPCTVTCGGGYQLNSAECVDVRLKRVVPDHYCHYYPENTKPKPKLKECSMDPC
PSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWK
CMYAPKPKVMQTCNLFDCPKWIAMEWSQCTVTCGRGLRYRVVLCINHNGQHVGGCNPQLK
LHIKEECIIPVPCYKPKEKNPVEAKLPWFKQAQELEETRTAASEEPTFIPEPWSACSTTC
GPGIQVREVKCRVLLTFTQTETELPEEECESPKPSTERPCLLEACDEVPSARGLDFSRHE
KHSETIYDWEYVGFTPCSATCLGGKREAIARCLHIQTQQAVNDTLCDLAHRPPAMTQGCN
TDPCPPRWQTGSWRPCSATCGVGIQTRDVYCLQPGEPLVPSEECKDEKPHVLQACNQFDC
PPGWHIEEWQQCSRTCGGGTQYRRVTCRQLLTDGSFLNLSDALCQEPRASSHKSCARTDC
PPQLVLGEWSKCSVTCGVGIQRRKPICQKLTSKGRNITLSGSLCRGRLHAPLVRSCRMTM
CNMIKPDVIPKYGAQGPQILGIKRVYIQTREEKRINFTIGGRAYLLPKTSVVIKCPVKRF
QKSLIRWEKDGQRLQNSKRLGITKSGSMKIHSLEASDIGLYRCIAGPVHETFILKLIGTD
NRLIEPPAFRDHLLERGRIDHNEANSLGATWHKMRQIWSQQNELYLDDGQVSDQPLLRAL
VHHGNNPAETPNSLEFKDKCLEAAVLQGSYSMDTVQFEELIKNMSQLMETGEVNDDIASQ
VIYEVVAELAKIQPTREKWRGAQLESSTTKLNMKSQNVSRGFNSKNPNRQTVKQKGLALM
KQNKLTPISFNKTINSRIGNAVFITQSTEIINLFCDLVKTNDAKYTWTKDGAVLQPSEKI
ILDGTRKIQIRNPTREEQGVYGCTVVNHPDSDTKTSSVLYAEGPVILAVARNFTEVEHGR
LTVTVGGTAKATVGANVTIKCPVKGIPQPNITWLKRGGSLSDNAFLLFNGSLMLKNVSLE
NEGTYVCTATNGLGKAMAASVLHLSKPRYPDIRVNLPQGNKKHVLIASNISTNINLTTGQ
MLHIEYNWEPGEWTHCSATCGNLGSRIQRPQCMTTKRQKVNETFCDHVQKPQNLVQPCNR
RDCPPRWLTSNWSECSVSCGNGFQHRQITCERVKASGIVQAMSPNACVHKDRPLGRKRCS
GQACGEWAVQLGSQCLSGQCLGRAQEMQRLPVLCQHQNGSVVSDLDCDERKRPTLRRNCS
SEPCDVYWRTGPWRPCTAACGNGFQSRKVECIHRKSSRPVAVHHCASRQRPVTWKHCNVT
SCGKGECKDTTHYCTFVKNLNLCSIELYKQRCCQSCQEV
Download sequence
Identical sequences G3X2L4
ENSSHAP00000021919 ENSSHAP00000021919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]