SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021920 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021920
Domain Number 1 Region: 14-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.47e-65
Family BAR domain 0.000000383
Further Details:      
 
Domain Number 2 Region: 288-349
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-22
Family SH3-domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021920   Gene: ENSSHAG00000018553   Transcript: ENSSHAT00000022095
Sequence length 352
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834466.1:3744669:3790765:1 gene:ENSSHAG00000018553 transcript:ENSSHAT00000022095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIPKNLRVSFFSFLQLISEKVSGVEKTKLDEEFLEMQRKIEITSKAIVELLAKCTECLQP
NPAYRVKLGMWNTMSRLKGQVLTSGYPQPEGLLGESMLRYGTELGENSMFGQALLDFGES
MKLLAEVKNSLDINVKQNFIEPLQLLQEKDLKEVGYHLKKLEGRRLDYDYKRRVSRISDE
ELQNAIGKFEESKDLARKGMNNLLENDIEQVSQLAVFVEAMLDYHRQSVEILLELHRKLQ
HRIRISSIFSNYTYNPSTPISTSKAGRHENFPHSSIKKDGTTRAGPSIHMDRPCCRALYD
FVPENEGELGFKEGDIITLTHQIDENWYEGIFEGQTGFFPINYVSVLVPLPH
Download sequence
Identical sequences G3X2L5
ENSSHAP00000021920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]