SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000021942 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000021942
Domain Number 1 Region: 643-711
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.02e-20
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1515-1574
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.58e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1346-1407
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.02e-16
Family TB module/8-cys domain 0.00017
Further Details:      
 
Domain Number 4 Region: 820-950
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 997-1117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000785
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 6 Region: 527-594
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000353
Family TB module/8-cys domain 0.0026
Further Details:      
 
Domain Number 7 Region: 1164-1282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000683
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 591-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000458
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 9 Region: 1117-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000146
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 1703-1754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000625
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 11 Region: 1414-1465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1673-1718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000263
Family EGF-type module 0.014
Further Details:      
 
Domain Number 13 Region: 1459-1504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000127
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 14 Region: 946-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000202
Family EGF-type module 0.006
Further Details:      
 
Domain Number 15 Region: 1275-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000488
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000021942   Gene: ENSSHAG00000018569   Transcript: ENSSHAT00000022118
Sequence length 1757
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834540.1:3750028:3935199:1 gene:ENSSHAG00000018569 transcript:ENSSHAT00000022118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYWRSFLPLTLAFFVGVGDAQRDLVGRYEPSGRDRGRLRRPGVNHSGATVGKVYSLFR
DQGGLGPGQPHGDVPQPVWGHLRNPTDGEIRRPLRTQQTRRVPPPVQMSAITLRQQSPPL
ARTASALQRPRTGQRVRAAPPPPPSSRGRLMGRNVCGGRCCPGWTTANSTNQCIKPVCEP
PCQNKGSCSRPQQCVCRSGFRGNRCEEVIPEEEYHPQPSWPVPRSPVGLPSLSRSSGLRE
NPASVVQSPVLQKLPTGNANQISHPISPQQQLRSSPTIRRYPGVVTGQLTSNALTGGNGH
EQSDSSHRAIHVAPGSSPWGLNLTEKIRKIKIVFTPTICKQTCSNGRCINDCSKGDTTTL
YSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTGKFCHLPALQVNRKPERP
PPVAPAEGSLKQSVYMLPLSNQLASVNPSLVKVHINHPPEATVQIHQVARVRGETEPHEE
NSVETRPAPRLPIRPGHEQWDINTITSQTREPPQLPPPSFPKPEGLLGWCYQNSVNDQCA
NPLRELTKQEDCCGSVGAFWGVNACSPCPPRPASPVIENGQVECPQGYKRLNHTHCQDIN
ECLLLGLCKDAECVNTRGSYLCTCKPGNMLDPSRSHCVSDKAVSMEQGLCFRSAGTGTCT
LPLAQRITKQICCCSRVGKGWGKKCEKCPLPGSESFREICPAGHGYTYSSSDIRLSMRKA
EEEELARSLEKPGERNNGTLIWTAGRQPLREVTASQSEAVATSAKGDSDGGQITATVDSM
PAGSLAPAIETPSPPLFGQVTPDPREEEKDTSLPSVASTLNKDNDRCATLAEDVCGPGTC
VNLPGKYSCVCNPGYQLHPSQAYCTDENECLRDPCKGKGRCINRVGSYSCFCYPGYVLIT
SAATQECQDVDECEQPGVCIGGQCTNTDGSYHCECGQGYIMIRKGHCEDIDECRHPSTCP
EGSCVNSPGSYTCLACEEGYRSQSGRCVDEDECLALGICLHGKCINLEGSFRCSCELGFQ
ATEDGKGCNDVDECASPGVCLSGICSNTIGSFSCNDCDRGYQPDALGRMCEDVNECEDPQ
VNCIGGECKNTLGSYQCHCPLGFQLINGTMCDDLDECAGEEECAPHGECLNTHGSFFCVC
APGFSSEPGGTSCQDVDECADIARCLGGQCLNTEGSFICVCEGGFRSSPENGECIDVDEC
KDFGDTVCGTWRCENSPGSYRCIMGCQPGFHMTPTEDCIDIDECANETLCGNHGFCDNTD
GSFRCLCDRGYEVSPSGWDCVDVNECELMVAVCGAALCENVEGSFLCLCADDHEEYDAQD
GRCRQRTVAGQESMKELTGENFPGPERKFCYSGPSNQSPCTSILGRNTTREECCCTQGAS
WGDSCDPCPFPGTVEFSELCPSGKGYIPVEDTWMFGQTTYTDADECLMFGSELCHNGQCL
NTVPGYICLCNPGYRYDASHMECEDHDECQDTACENGECVNTDGSFHCFCSPPLVLDPSQ
RHCVNSTGSMDLPDHDIHMDICWKKVTNYVCSQPFRGRRTTYTECCCQDGEAWSQQCALC
PPRNSEVFAQLCNVARIEAEREAGLHPRPGYEYGPGPDDLHYGLYGPEGAPFYNYLGPEE
GASESPFLHPGSGPVPNLPALEPPLQPSEVQPHFLGNRPGNYDSFEGLRAEECGILNGCE
NGRCVRVDEGYTCDCFEGFQLNIAQMACVDINECENMHGLIAPCAHGHCENTEGSYYCQC
PVGYVAMAGPPRCIPKE
Download sequence
Identical sequences G3X2N7
XP_012403220.1.9362 ENSSHAP00000021942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]