SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000022330 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000022330
Domain Number 1 Region: 771-951
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.97e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 926-1047
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.04e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 131-161,254-383
Classification Level Classification E-value
Superfamily PH domain-like 3.59e-28
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 16-125
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000246
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000022330   Gene: ENSSHAG00000018900   Transcript: ENSSHAT00000022508
Sequence length 1177
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849868.1:4563031:4761988:-1 gene:ENSSHAG00000018900 transcript:ENSSHAT00000022508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEIRRRSQKPDPGSAREGLLLLNSPYLRCVPAPSGCGGGTGGRPSPPGPLPNPSVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPENPESPMACHVFRATDPNQVPDVISSIRQVSKA
ALKEDTKPNKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSTLIDDCIEKFSLHERQRLRLL
SEQRNSDSSNDLMVFESEVPISPVDGQFEELDETTSPASGLTMVVGQTSLPGSRIGFPER
ILEDSGFDEQQEFRSRCSSVTAVSQKKVHDGALKVQPRRRHASAPSHVQPSDSEKNRTML
FQVGRFEINLISPDSKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSQYICYVF
QCASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKL
VIQRHLSSLTDNEQADIFERVQKMKPVNDQEENELVILHLRQLCETKQKTHIHIGETQST
LSNNAVPENVGSSGRFKLDVLKNKAKRSLTSSLENIFSRGANRMRGRLGSMDSFERSNSL
ASEKDCSPGDSPPGTPPASPLYPAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKIALQD
GRSQGVQSPLLRQNSIEQCSDGEGRKRTSSTCSSDSLNIGGFPVTPRRVSWRQRIFLRVA
SPMNKSPSAMQHQDGLDRNELLPLSPLAPTMEEDPLVLFLPDEDEPEKVDGRRKSEELRS
LWKKAIHQQILLLRMEKENQKLEASRDELQSRKVKLDYDEVGICQKDTLLTWDKKLLNYR
TKIRCDLEDIHITLKEGVPKSRRGEIWQFLALQYRLRHRLPSKQQPPDISYKELLKQLTA
QQHAILVDLGRTFPTHPYFSVQLGSGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLH
MSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPS
LYAAPWFLTLFASQFPLGFVARVFDIIFLQGTDVIFKVALSLLSTQEALIMECENFENIV
EFLKNTIPDMNISEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESAHSCDESEPLEK
LEKANNQLKRQNMDLLEKLQVAHAKIQSLESSLENLLTRETKMKSLIRSLEQEKLTYQKT
VEQIRKHLPADALADCELLLREVNCNPNNKARTGNKP
Download sequence
Identical sequences G3X3S5
ENSSHAP00000022330 ENSSHAP00000022330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]