SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000307 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000307
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000035
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000307   Gene: ENSSHAG00000000271   Transcript: ENSSHAT00000000312
Sequence length 298
Comment pep:novel scaffold:DEVIL7.0:GL865277.1:248:13518:1 gene:ENSSHAG00000000271 transcript:ENSSHAT00000000312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDPQDIKQNNKQAFDGFAALGVSRLLDPADMVLLAVPDKLIVMTYLCQIRAFCTGQELQL
VQVEGGGRASTYRVGGPEPELPAALGSGPLAQRLRERSGDMAGATPANPGPSKDPAKVAG
RQPKEEAGRAGLPALNGEAGMGPIPPPRAHGSFSHIRDADLLKKRRSRLRSSSSLSVDDA
ESGATGPSGTKCIKTASEGETGDGNPPAEEALPSSSSGVSPSEEPGMDTSQYVCAELQAL
EQEQRQIDGRAAQVETQLRSLMETGANKLQEEVLIQEWFTLVNKKNALIRRQDQLQLL
Download sequence
Identical sequences G3VAV3
ENSSHAP00000000307 ENSSHAP00000000307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]