SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001230 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001230
Domain Number 1 Region: 3952-4308
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.37e-131
Family Hect, E3 ligase catalytic domain 0.0000000312
Further Details:      
 
Domain Number 2 Region: 1661-1725
Classification Level Classification E-value
Superfamily WWE domain 3.4e-17
Family WWE domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1349-1402
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000672
Family UBA domain 0.0059
Further Details:      
 
Domain Number 4 Region: 84-168,230-433,569-732
Classification Level Classification E-value
Superfamily ARM repeat 0.0000242
Family Plakophilin 1 helical region 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001230   Gene: ENSSHAG00000001097   Transcript: ENSSHAT00000001245
Sequence length 4315
Comment pep:novel scaffold:DEVIL7.0:GL867626.1:6845:105536:-1 gene:ENSSHAG00000001097 transcript:ENSSHAT00000001245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDRTKLKKTPTEAPADCRALIDKLKSCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMAWMLMCDGPQKEHLKLLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLSRLQHLAESWGGKENGFGLA
ECCRDLHMLKYPPSATTLHFEFYADPGAEVKVEKRTPSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHKKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMDIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPSTAHEGEEMETDTDVAEVAMESSPGPSTASVDPRPDVETRSRAPSISGSIMLPPRTGV
QCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSLKHIISNAEYYGPSLFLLA
TEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREVLGSLPNVFSALCLNARGL
QSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLGSAVDELMRHQPTLKTDAT
TAIIKLLEEICNLGRDPKYICQKPSIQKADGTSTAPPQRANHAAEEASSEDEEEEEVQAM
QSFNPPAQSDTDSNQQVVGTEERVPIPLMDYILNVMKFVESILSNNTTDDHCQEFVNQKG
LLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKVLQEGLLQLDSILSSLEPL
HRPIEAPGGSVLLRELACAGNVADATLSAQATPLLHSLTAAHAYIMMFVHTCRVGQSEIR
AISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSLPSGCEFGQADMQKLVPKE
EKAATTTATHGTKRTEGESDGTTASVEASAQGLLEGIGLDGDTLAPMETDEPSTSDAKGK
SKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVRQRRSHHATSTTTAPT
PAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSPMLFDERKYPYHLMLQ
KFLCSGGHNALFETFNWALSMGGKVPVSEGLEHPDLPDGTGEFLDAWLMLVEKMVNPTTV
LESPHSLPAKLPGGQTHPQFSALRFLVVTQKAAFTCIKNLWNRKPLKVYGGRMAESMLAI
LCHILRGEPVIRERLSKDKEGTRGEEESGQEESGSRRDPQVNQQQLQQLMDMGFTREHAM
EALLNTSTMEQATEYLLTHPPPLMGGVVRDLSMSEEDQMMRAIAMSLGQDIPMDQRAESP
EEAACRKEEEERKAREKQEEEEAKCLEKFQDAEPLEQEELHGFTDTMLPGCFHLLDELPD
TVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAALPLTTSDTKTVTEWINQ
MITLPQASNLATRILLLTLLFEELKLPCARVVETSGILNVLIKLLEVVQPCLLAAKEQKE
IHTPKWITPVLLLIDFYEKTSISSKRRAQMNKYLHLSNNNWRWFDDRSGRWCSYSASNNS
TIDSAWRSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVMLSLLRAPRVNKIPKESH
EPELDKTLDETKEAESKPAEEEKTSSECPLAPESPALEKEVVVQKEVVVQKEVQLGDILI
QGLTGEMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYALMFAELKSTRMILNL
TQSSGFNGFTPLVTLLLRHIIEDPCTLQHTMEKVVRSAATSGAGSTTSGVVSGSLGSREI
NYILRVLGPAACRNPNIFTEVTNGCIRIALPAPRGSGTDDEFENLRVKGPNAVQLVKTTP
VKPSPLPLIPDTIKEVIYDMLNALAAYHAPEEAEKLDPKPGVTTQEVSQILQDMGDEVYQ
QYRTLTRQGSDFDAQAGFAINAQVFATDSSSTETPQSGTPQGGASTPEESREGKKDKEGE
KVSEESKQKAKGSKPLMPTSTILRLLAELVRSYVGIATLIANYNYAVGQSELIKEDCSVL
AFVLDHLLPHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKAALSRALAMAES
TEKHARLQAVMCIISTIMESCPSTSSFYSSTTAKTQHNGMNNIIRLFLKKGLVNDLARVP
HSLDLSSPNMANTVNAALKPLETLSRIVNQPSSLFGSKSASGKNKAEQDAQGVAQDASSN
TQDPGEPGEAEVQEEDHDAAQTEVADGDIMDGEAESDAVVIAGQPQVLSTPEMQVENELE
DLIDELLERDGASGNNAILVGRSGEDESQEDVLMDEAPSNLSQASTLQANREDSMNLLDA
EDEEEHTQEEDSSGSNEDEDESQDEEEEEEEDEEDDQDDEEGEEGDEDDDDDGSEMELDE
DYPDMNASPLVRFERFDREDDLIIEFDNMFSSANIPPSPGNIPTTHPLMVRHADHSALTL
GSGSSTTRITQGMSRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADIL
QLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTR
WTEECKVLDAESMHDCVCVVKVPVLNRLEFLRDEELEERRDKRRQQLLEGEAKSKEEKEN
KDQNPQDTTPKTDSSSTKQSIAASLSPERAEDSDALTAVSSQLEGSPMDTSSLASCNLEE
GVGDGTTTSGAEAPEPAPTTPGDAPQTGAETQGSGDEPGESPEESPQQAEDSSPQGSSSE
SSSTRDSAVAISGADSRGLLEEPLPSTSSEEEDPLAGINLPEGVDPSFLAALPDDIRREV
LQNQLGIRPPARVAPAATTPTPPPVVGNPNVTEVSPEFLAALPPAIQEEVLAQQRAEQQR
RELAQNSSSDTPMDPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEAR
QRQLMHERLFGHSSTSALSAILRSPAFTSRLSGNRAVQYTRLAVQRGGTFQMSGSSSHTR
PSGSNVDSLLRLRGRLLLDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHGQTRHWVI
RSLLSILQRSSESELCIETPKATASEEKGKKAAKVCPTGSHDSRPLDLLHKMESKSSSQL
SWLSVSMDAALGCRTNIFQIQRAAGRKHSGCGSTVHIHPQAAPVVCRHVLDTLIQLAKVF
PSHFTQQRTKETTCDSDRERSNKQTCSPCPGQSTSSGISTDFWDLLVKLDNMNVSRKGKN
SVKSGPINVGSEGESSLYSLEASPLGQLMNMLSHPVIRRSSLLTEKLLRLLSLISIALPE
NKPPETVANPSSSTGTPSTTTASSTSAASTNTGVATPATLTPSPTPAGASAAAPVAPTTT
TVPTVVAATAKSGKSPAKAGEGSSAGTMDSKMAASGLTENQLQLSVEVLTSHSCSEEGLE
DAANVLLQLSRGDPATRDTVLKLLLNGARHLGYTLCKQIGTLLAELREYNLEQQRQAQCE
ILSPDGLPEEQPQATRLKGKMQSRFDTAENVVIVASQKRPLGGRELQLPSMSMLTSKTST
QKFFLRVLQVIIQLRDDTRRANKKAKQTGRLGTSSLGSASSIQAAVRQLEAEADAIIQMV
REGQRARRQQQAATSESSQPEVATRRDESPMDVDQPSPASQDTQSIGSEGSQQSEKEKEE
RPPDLPLLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPP
VRDTRESQLAHIKDEPPPLSPAPLTPATHSSLDPFFSREPSSMHISSSLPPDTQKFLRFA
ETHRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAV
HVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYA
LFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGK
SVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVT
EENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDI
DDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNG
IQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESYEKLRHMLLLAIQECSEGFGLA
Download sequence
Identical sequences G3VDH6
ENSSHAP00000001230 ENSSHAP00000001230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]