SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001534 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001534
Domain Number 1 Region: 68-128
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000458
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily RING/U-box 0.000000286
Family RING finger domain, C3HC4 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001534   Gene: ENSSHAG00000001368   Transcript: ENSSHAT00000001550
Sequence length 238
Comment pep:novel scaffold:DEVIL7.0:GL850527.1:10408:16758:1 gene:ENSSHAG00000001368 transcript:ENSSHAT00000001550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTSVSLREEEESLCSVCWTLESNIVTIECGHGACLSCLQKKSSLPFCCKRCWEFSQLKS
VQADIAMNPEGEGICELHREDQKLYCENEKTLLCVTCSKSEDHENHMHWPIAVAAVGYRK
MLQIEMKMLDYSAKKIQEFQCQEKKKSLAWAVMWSRSLKEKMQVIWEYLKKEKTEEEKVE
TAKIEDLEHDIMEKRKEWEDMTSRYVRFLRDKITILEEKTQKTNVELLKDLRNTFARY
Download sequence
Identical sequences G3VED0
ENSSHAP00000001534 ENSSHAP00000001534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]