SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002521 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002521
Domain Number 1 Region: 10-256
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.56e-23
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002521   Gene: ENSSHAG00000002233   Transcript: ENSSHAT00000002549
Sequence length 291
Comment pep:novel scaffold:DEVIL7.0:GL865021.1:26506:28349:1 gene:ENSSHAG00000002233 transcript:ENSSHAT00000002549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFWNIVSGRTFSIILLSLMVLLGLGGLVGNGLMLWLLGFRAKRNPFSVYILHLAGADFLF
LGCQTVFAILSFSRGQQPLYLVVAFLWFVAGLGLLVAVSLEQCLVALFPRWSARRPKHTS
ACTCALVWALSLLLVPGHACGLLSGGSSWLTCFQYHAVSSICMFLLFSALCVSSVVLLVR
VQCCSQSSSKPPFYCFVLQLVPLFFFCGLPFLVYWTVKNTLGSLASFFSFFLSIAELLAC
VNSSTKPLVYFCNASHRQDLQRHPLKRIVQKQLDLASALCPKTDEPPLGLF
Download sequence
Identical sequences G3VH67
ENSSHAP00000002521 ENSSHAP00000002521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]