SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002801 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002801
Domain Number 1 Region: 785-979
Classification Level Classification E-value
Superfamily Macro domain-like 2.19e-55
Family Macro domain 0.0000501
Further Details:      
 
Domain Number 2 Region: 1009-1191
Classification Level Classification E-value
Superfamily Macro domain-like 1.24e-44
Family Macro domain 0.00019
Further Details:      
 
Domain Number 3 Region: 1201-1393
Classification Level Classification E-value
Superfamily Macro domain-like 3.03e-42
Family Macro domain 0.00075
Further Details:      
 
Domain Number 4 Region: 1623-1804
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.81e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.025
Further Details:      
 
Domain Number 5 Region: 1535-1600
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000209
Family WWE domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002801   Gene: ENSSHAG00000002478   Transcript: ENSSHAT00000002832
Sequence length 1805
Comment pep:novel scaffold:DEVIL7.0:GL849583.1:38447:104148:1 gene:ENSSHAG00000002478 transcript:ENSSHAT00000002832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISDSFSLVLDGPWGPNPPKKLLKKLQCYFQSPRRSGGGKCVLTTQVGCSKILLLFYHE
EARQRVLERENHELELPGEEKLKLTVRLPTAKDEDEDNEEQISTEVKNPEQESTTKGRAQ
EQEDQYTKLSLDRTLDETEDTSKGSETFHSLVALKNLQDQEDEYFLVLLVENISGLSKAE
GDFEVEAIPEAEAAVFTFLKHIDIKKFIDRCSQNQVVQEKKILVEPLEETRTILVENLPP
NVNEIYIILFFENPNNGGGPITEIQSFPKDNSALIQFSECKVVKTILTKKLLFNNSPISM
FPYYYSLGTALYGKAKRQVKLPEPLKMPMEPYLLKFLQKDDQIIEKIISTMESYHCVLTW
PRTDCKNPEIILCPSATLVNKKTKMNLIKMWSEDVSLKFSCLMSDYQVSKYKVNLLIWEA
IRNSIENHSILTEFDKFQETVIIAGRVEDVQRAELQMKTLVEREKQSIRENLIVCPGRFS
ILCKCGLEETLHKEYPELEYTYNALTKSICLRGLAADVYKAKSEILEKLQSLAQKSLHLP
PQIIQFLQQLNCELFSESLFGAEKIPAVYDLEGEAVVLVGSSLQVLCEAEKHIKKALDFK
CINLADSRILNNPQWKTLIDDLKKKYNRSSKTVIIEEQNSDAGVKIMVAGCVSPVGESYQ
ELYEFIEKNTKIEELVAVKSLGVIQYMKDENKQIWEKLKEKSIKVDFKTQATQKGILLSG
PKGEVIRGVAIVKQALESIHVKNFAIDKPGAKSLFKNKEEYYTREAKLKYNCYIWLQEDG
EENSGGNINGQKIYCQITLKCGILLTVQKGDLTQFSADVVVNAANENLKHYGGLAAALSK
AAGPELQRDCDRIIQVQGRVHPGCAVVSAAGQLPYQQVIHAVGPRWRQEHAHRCVQLLKN
AVTEILYLAGEFGHTSVAIPALSSGVFGFPLKECAETIILAIKENFQHSQKHSLKKIHLV
DSSEETVQAFSKAMQTIFKDVLPSNNSLSSATLENQKTTMKKSIEHRNILNSIQTSEHLR
IILMKGDIQDAETDVIVNSIPLDLHLNSGQLSGALFKKAGPEIQEELNTLEKKAVKTGSV
LLTKGYNLDCMFVLHVVAPNWDDGAGKSQKIMKNIIRECLETAASLSLTSITFPAIGTGN
LRFPKNVFAKLIMSQVFEFSRSGLLKTLKEVCFLLHPSDTDNIQAFKKVFTTYSDGNITS
ERVSNTSDTQGLFDTISSPKLGVYESKIGSIIFQVASGDITKEESEVIVNSTDKTFVLKN
GVSKAILEAAGPAVESECTTLGVKCQKNFIVTQGGNLMCKKIIHVIGGNDVKQTVSEVLQ
ECEKMNYVSVSLPAIGTGQAKKDPTNVAESIMDAIEDFAHKGPGQSLEKIKVVIFLPELL
KVFHDVMKKRVTSKLSRSNPVISVIKSLLGFASQPPPKQDYLVLEKIKKSSTFQVCGESK
KNIESTISWIQDLILKELLSNTFSDEYIQKFGEKEYNELNELQKKLNIIIDVKREESEIK
VTGTAQDVITASRAIEDMIKRTHLHIDEELKAEELSKTTIWQYIDNGVSKSFDKITNLHL
ENARKEKKKKIEVKIQNENYTVDFVKSLATNGKGKELRVHCIRKHEVEIPNYWDDMKDQN
LLLVDLPPAHQEYKQVKDKFCQTCPRYIIEKIQRIQNKCLWNLYQARKISMEEQNKQTNN
ERFLFHGTDANSVPGVNNQGFNRSYAGKNAIAWGKGTYFAVNANYSASDTYSRPDINGKK
YVYYVRVLTGDYITGNSSLIVPPSKGPQAADVLYDSVTDNMQNPSLFVIFFDNQSYPEYL
ITFRK
Download sequence
Identical sequences G3VHZ7
ENSSHAP00000002801 ENSSHAP00000002801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]