SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003493 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003493
Domain Number 1 Region: 328-448
Classification Level Classification E-value
Superfamily SET domain 7.72e-28
Family Histone lysine methyltransferases 0.04
Further Details:      
 
Domain Number 2 Region: 91-155
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.75e-16
Family PHD domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003493   Gene: ENSSHAG00000003068   Transcript: ENSSHAT00000003529
Sequence length 1847
Comment pep:novel scaffold:DEVIL7.0:GL861639.1:50429:133206:1 gene:ENSSHAG00000003068 transcript:ENSSHAT00000003529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLPYADHNYGARPPPTPPASP
PPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTRCICGFTHDDGYMICCDKC
SVWQHIDCMGIDRQHIPDIYLCERCQPRSLDKERAVLLQRRKRENMSGLKDGDTSATESG
DEVPVELYTAFQHTPTTITLTAARVTKVNDKKRKKSGEKEQNISKCKKSFREGSRKSSRV
KGSAPEIEPSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREAQRIALRLGNGNDKKEM
NTKSESNASNLIFKPPVESYIQKNKKILKSAKDLPPDALIIEYRGKFMLREQFEANGYFF
KRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEDGTIHLYIYSIQS
IPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRCSEPTENINSGYETRRKKGKKE
KDISKEKETQNQNITLDCESVTNKMRSPDNKQRKLSPLRLSISNNQEPDFIDDIEEKTAI
SNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQALERISTAKTEIKTE
CKDTQIVNDAEVVQETTKEETASKPTPAKVNRTKQRKSFSRSRTHIGQQRRRHRTVSMCS
DIQPSSPDVEVTSQPNETENTALAAEPETETAIAEVVTETEVPALNKCPTRYPKTKKHLV
NEWLSEKNEKTGKSSESLSERPLRITTDPEVLATQLNSLPGLTYSPHVYTTPKHYIRFTS
PFLSEKRRRKEPSENNSGSCKKRWLKQALEEENSAIIDKFNSLCQERSRSPAVNGENKSP
LLLSDSCSLPDLTTPLKKRRLYQLLDSAYSETSTPTPSPYATPTHMDVTATDASLFATPP
RTKSEDETCRNGYKPIYSPVTPVTPCLQGNAMHFENISSPESSPEIKRRVYNQEGYERTP
TLLTVGPFRNSNLTEMGLQEIKTIGYSSPRNRTDITRQCTGDKESVSDLQTGVDVVEQHA
AISKTMETPSQDRTDSNSQLEPSPCGRGTIYSSWVKSPERTGVNFSSVNSNLRDLTPSHQ
LEVGGGFRVSESKCLVQDDSRGVFMETSVFCSSEDGLPPGFGRTINDSTIEGSCTPQNPP
QKKKVSLLEYRKRQREARKSGSKADNFSLVTVSPHTTMGGNMSSSSSTTDGCSNGGENGE
QIDHTASLPLPLPNTVYNAASEEISNNCPIKETSGEKNEPEVQWTASTSVEQVRERSYQR
ALLLSDHRKDKDSGGESPCIPCSPNHVQSSPSSHSNHIPQLQLKVPVPSFSELIEDPDPE
NPEPTTTNECPSPDTSQKTCKSPSKVSKPCSPGPIVPAQSLGKTPTKPDSQWETAVKTPE
TENANLPKAELQQKQLSNNVQALSKTHSSQSHVRSSAEQLSQKLPSAPLKLHCPPSPHVE
NPPKSSTPLTPVQHGYHSPKPHAQQLGSPYRAHHSQSPQVGTPQRDSHRNFYPAAQSLQS
NTPQPATGALFTQTPSGQSSATYSQFNQQNLNSTAPPPPPPPPPSSSSYYQNQQPSANFQ
SYNQLKGSLSQPTVFTSGPNQALPGTTSQQQVPGHHVTSGHFLPSQNSTIHHQASAAPPP
PPPPPAPGPHLVQQPSAHQQHSVAHVVGPVHAVAPGSHIHSQPAGHHLPPPPPPPAPAPH
HHPPHPAPGHQGLQAQHQHVVNTAPPPPPPPPSSVLASGHHASPAPALHHPSHQGPPLFP
SSAHPAVPSYPSQATHHTPLGPGPQHQPTGTGPHCPLPVQGPHLQPQGPNSIPTPTASGF
CPHPGSVTLPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
Download sequence
Identical sequences G3VJY8
ENSSHAP00000003493 ENSSHAP00000003493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]