SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004923 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004923
Domain Number 1 Region: 5-292
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.1e-22
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004923   Gene: ENSSHAG00000004313   Transcript: ENSSHAT00000004972
Sequence length 299
Comment pep:novel scaffold:DEVIL7.0:GL865084.1:98799:99695:-1 gene:ENSSHAG00000004313 transcript:ENSSHAT00000004972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSYDSVLCIIYVLLIIIGTFGNGFLLFSSGCNIITNQRTRPIELIFFNLAFSNIMLILL
RGIPWSVQFCIQKFFLGDIDCKITLYLQRVFRSISLCTTCLLSVFQGIAISSHNPICTEL
KARFPKNIVSFSVGIFVLNLLIDGIVPLYVRGSKYNTKSNLSGDIGYCSIDRYALTTSKF
IILKSLYDAVFMGFMTIASGYMVLVLYRHHWQVHHIHNANYNSSTSPETRATKIILLLMS
SFICFYSLSSIFIIVMDNSKDTNLWLIHSSVVFSLCYPTISPFLLISSDSQIPNFYYAF
Download sequence
Identical sequences G3VP18
ENSSHAP00000004923 ENSSHAP00000004923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]