SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000005397 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000005397
Domain Number 1 Region: 68-184
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000231
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000005397   Gene: ENSSHAG00000004716   Transcript: ENSSHAT00000005451
Sequence length 184
Comment pep:novel scaffold:DEVIL7.0:GL842638.1:117891:138272:1 gene:ENSSHAG00000004716 transcript:ENSSHAT00000005451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVVKEQIMRALTTKPSSLDQFKSKLQNLSYAEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNSRRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKRNVSSDCMVSDKSCIGLSAPGTAPGGTEVLELAFSILYDSNCQLNFIAPDKHE
VRRW
Download sequence
Identical sequences G3VQE2
ENSSHAP00000005397 ENSSHAP00000005397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]