SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007752 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007752
Domain Number 1 Region: 746-916
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.12e-30
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 614-702
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000101
Family WWE domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007752   Gene: ENSSHAG00000006732   Transcript: ENSSHAT00000007815
Sequence length 925
Comment pep:novel scaffold:DEVIL7.0:GL861661.1:254016:307490:-1 gene:ENSSHAG00000006732 transcript:ENSSHAT00000007815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLNYCYIRTNYCKYSHDIHSEKNIKILKKHDISVLSKNELAVLLLQSDPFFLPDICKYYK
GENKKDSCTNTECMKLHICEHFVEGKCGFVNCIRSHDLMGTKVLELLKEEGLTIPVIRNI
QDICDQKHIRSKKRISRRRDKSTQRNVGYRSQSRNRYFFGTQELPTSPSASVETAHIPEP
DKTGSAPLPSSEGKVNEKGVPENNSSLRQDSVQSVSASTKTVSIQQASQLGTNLSRREGQ
YGTQDGTQHAVSISAPAPAAPAGDSQLFRRVKVLFGNDDDSCSDPAPQTTSKSESMSSSN
ATSAGNDCEGQKAHPSLAPNKIVDTWDKNDREETLCMPQKDQASPRDKAAAAYVQPKTPS
ASDVPQSGIKKDGLAQSSLPTGKHKFTNVFIYRHINNVFYGSKLLPRQSYCVAKEGITQL
DLCMYLYALKNLDSIGSPKGSVSASPSQTLATLGINKSRAVSPSKSTNAEGKKLSTAEIA
SQCESVPSSTLDSFISQTHSNQDVPVSQARILNTIPSGMENNNSNKICLDYLNGDCKLKE
CCKDIHFYLPYRWQVCISNVWEDLKDMEEIEKAYCDPTIYKCPLRSHSIDFQEMLLFGFY
PVRRLSTPSTIQNSTCALSTKWHWYWKNELDQWIEYGKEKKGYFKQEDSEFTSEDLELFF
LVSPETVSLSHHKYKLNFNDMTQTNIVSGITREVRRRPQFVSSVTVYWNQKRKKLKDEQK
EKPQSVYLCQSYYRKQDISFISQSKYKLFEIKRPSFEYSEIEYSFKSTMKNFEIQKIMRI
QNPSLWNNFQRKQKKMLNGGNKKLLFHAADPNSIDSICSNNFSIWSPQSFQQTIYGTGIY
FTKDAISSHYKIKNNHKIKIMFIAQVLVGMSVQGKVGYTSQNLPIYDSYVDNMTNPSIFV
INDKENIYPHYIIEYTDIDKSCNIS
Download sequence
Identical sequences G3VX47
ENSSHAP00000007752 ENSSHAP00000007752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]