SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000007775 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000007775
Domain Number 1 Region: 986-1199
Classification Level Classification E-value
Superfamily SET domain 2.62e-73
Family Histone lysine methyltransferases 0.00096
Further Details:      
 
Domain Number 2 Region: 199-350
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.75e-27
Family PWWP domain 0.0042
Further Details:      
 
Domain Number 3 Region: 881-982
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.26e-26
Family PWWP domain 0.0000191
Further Details:      
 
Domain Number 4 Region: 825-893
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000332
Family PHD domain 0.004
Further Details:      
 
Domain Number 5 Region: 420-487
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000102
Family HMG-box 0.0022
Further Details:      
 
Domain Number 6 Region: 1223-1290
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000244
Family PHD domain 0.0058
Further Details:      
 
Domain Number 7 Region: 667-717
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000126
Family PHD domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000007775   Gene: ENSSHAG00000006750   Transcript: ENSSHAT00000007838
Sequence length 1371
Comment pep:novel scaffold:DEVIL7.0:GL864875.1:255407:330700:-1 gene:ENSSHAG00000006750 transcript:ENSSHAT00000007838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQVPEILGSTNGKTQNCEVNRECSVFLSKAQISTTLPEGVMQKFNGHEALPFIPADKLK
DLTSRVFNGESGAQDTKLRFESQEIKGIGTPPHTTPIKNGSPEIKLKITKTYMNGKPLFE
SSICGDNGPDVSQSEENEQKLENKSRRNRKRSIKYDSLLEQGLVEAALVSKASSPSEKKI
LAKRESYPNINKEKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSAR
QYHVQFFGDAPERAWIFEKSLVPFEGEEQFEKLCQESAKQAPTKAEKIKLLKPISGKLRA
QWEMGIIQAKEAVNMTVEERKDKFTFVYVRDRLHLNPQVAKEAGIAVDPLEEVDESSDVS
EETAQNPKYKELGVPNKRRRRSKLPTCPDNQESDSGTKNITPQRAAEQVDSKRGLGSPVG
RKKAAASTPRSRKGDSGSQFLVFCQKHRDEVVAEHPDASSEEIEELLESQWNMLNEKQKA
RYNTKFAIVTSPKSEEDSGSSLKNIGETKRKVFQDSPKRRSRSRSNLHGKKRNHTKRTQH
PTEDFEVQEPARKRLRMDKHNNRKRETSSDKTAKTNSSKVTETSSSLKNQSATKNLSDAC
KPLKKRNRASAAESSTLAFSKSSSPSTSLTENEISDGQGDEPSESPYESADETQTEISIS
SKKSERGTTAKREYVCQLCEKSGNLLLCEGPCYGAFHLSCLGLSRRPEGKFICSECTSGI
HSCFVCKEKKTEVKRCVVSQCGKFYHEACVKKYHLTVFESRGFRCPLHSCVSCHVTNPSN
PRSSKGKMMRCVRCPVAYHGGDGCLAAGCSVIASNNIICTNHFTARKGKSHHAHVNVSWC
FVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCRAGKKLHFQDIIWVKLGNYRWW
PAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGIKGI
GKVFKNALQEAEARFREIKLQREARETQENERKPPPYKHIKVNKPCGKVQIYTADISEIP
KCNCKPTDENPCGFDSECLNRMLMYECHPQVCPAGEQCQNQCFTKRQYPETKIIKTDGKG
WGLVAKRDIKKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKG
NYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCG
ASNCSGFLGDRPKNSAALSSEEKGKKTKKKTRRRRTKGEGKKESEDDCFRCGDGGQLVLC
DRKCCTKAYHLSCLDLVKRPFGKWECPWHHCDVCGKPSVSFCHFCPNSFCKDHQDGTVFS
TTQDGRLRCSEHEFGVESIRNPKTEKPFPEPTKLKPKRKKRRCWRRKTEYK
Download sequence
Identical sequences G3VX70
ENSSHAP00000007775 ENSSHAP00000007775 XP_012407831.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]