SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000008578 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000008578
Domain Number 1 Region: 15-40,89-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-24
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 168-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-16
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000008578   Gene: ENSSHAG00000007431   Transcript: ENSSHAT00000008649
Sequence length 294
Comment pep:novel scaffold:DEVIL7.0:GL856883.1:315718:322865:-1 gene:ENSSHAG00000007431 transcript:ENSSHAT00000008649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGWGLFDWRGNWTLSLLLGYFCYLLLGATIFQLLEKQAEAQSRNQFQLEKLRFLENYTC
LDQQALERFVQVIMEAWDKGVNPTGNSTNPSNWDFSNSFFFAGTVVTTIGYGNLSPSTEA
GQIFCIFYALFGIPLNVVFLNHLGTGIRSHLVTTETWGHRPRRYQVVQTLGLALFLTVGT
FLLLIFPPMVFSHVEGWSYGEGFYFAFITLSTIGFGDYVVGTDPDKHYISVYRSLAAVWI
ILGLAWLALMLPLGPLVLHQLMHLWPQSKDPTSKKGIVPEADGLSHPMKLPIAV
Download sequence
Identical sequences G3VZH3
XP_003769084.1.9362 ENSSHAP00000008578 ENSSHAP00000008578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]