SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000009445 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000009445
Domain Number 1 Region: 982-1240
Classification Level Classification E-value
Superfamily SET domain 4.19e-85
Family Histone lysine methyltransferases 0.0000339
Further Details:      
 
Domain Number 2 Region: 723-967
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.71e-65
Family Ankyrin repeat 0.0000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000009445   Gene: ENSSHAG00000008173   Transcript: ENSSHAT00000009528
Sequence length 1280
Comment pep:novel scaffold:DEVIL7.0:GL856874.1:392474:411667:-1 gene:ENSSHAG00000008173 transcript:ENSSHAT00000009528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAAAAAEVRKGRGGGRGPLPGNRGRGRGTTHRGRGRGRSLLSSARTQACWASLPPVRL
TSSPTPCLPSQGEAPGEMGGALLLEKEPRGTAERGLSSSGDKCPGEETPSQDHPESVEPT
GPSSPASVTVTVGDEGADTPVGSTPLIGDEPESPEGDEGIHNNRILLGHATKSFPSSPSK
GGSACPSRAKITMTGAGKSPPSVQSLAMRLLSMPGAQGAGAGPEPVPTSTPIPTSPEGKP
KVHRARKTMSKPGNGQPPVPEKRPPEVQHFRMSDDLHSMGDMGTDIAKRRKMDLGSGGPH
KRGPHGLLEELDPAGGTEDMTLEKENQEAMEDWDTDVGEGFSLYYDSYSVDERIDSDSKS
EAEVLAEQLSEEEEEEEEEEEEEEEEEEEEEEDDEESGNQSDRSGSSGRRKAKKKWRKDS
PWVKPNRKRRKRETPRTKEQRGVNGVGPSGPSEYIEVPLGSLELPSEGNLSPNHAGVSND
TSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESMDGELSGCSAGIQKRETMR
PSSRVALMVLCETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGM
VFCPHCGEDASEAQEVTIAWSDGVAPPPGTAAPVPPPPAQDAPGRADTSQPSARMRGHGE
PRRPLCDPLADTIDSSGPSLALPNGNILSAVGLGAGPGREALEKALVIQESERRKKLRFH
PRQLYLSVKQGELQKVVLMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGAN
INAVDKLQRTPLMEAVANNHVEAARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLL
LSTGQVDVNAQDNGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNEENICLHWASFTGS
AAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGADPELRNKEGDTAWDL
TPERSDVWVALQLNRKLRLGVGNRVLRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDY
KYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIE
PPLIFECNQACACWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGE
LISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQD
LRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLA
RLDPHPELIADLGSLPSLSS
Download sequence
Identical sequences G3W1Z0
ENSSHAP00000009445 ENSSHAP00000009445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]