SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000010988 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000010988
Domain Number 1 Region: 2094-2307
Classification Level Classification E-value
Superfamily SET domain 7.85e-65
Family Histone lysine methyltransferases 0.00041
Further Details:      
 
Domain Number 2 Region: 2468-2580
Classification Level Classification E-value
Superfamily Bromodomain 4.97e-22
Family Bromodomain 0.0015
Further Details:      
 
Domain Number 3 Region: 2600-2664
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000013
Family PHD domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000010988   Gene: ENSSHAG00000009472   Transcript: ENSSHAT00000011082
Sequence length 2993
Comment pep:novel scaffold:DEVIL7.0:GL856822.1:548326:726820:-1 gene:ENSSHAG00000009472 transcript:ENSSHAT00000011082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHRNTAMLGVGTDSEGFSRKSPSAVSTGTLVSKREVELENSTKEEEDLWRRNRDRNIET
GKNDGLTDAQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTSIKHPRK
ALKSGKMTDEKNELCPSKRTMSGIYISTLQNNMYVTHWRRGEKDPSKLYKKANDVAAVEC
RSEEGIHLHSQGENNPVSKKLSPLHSEMTDYVKSAPSTLVGNRDPDSKDRALLNGATSVT
EKLAQLIATCPPSKSSKTKPKKLGAGITAGLVSKDLIRKPGIGPMAGIIHKDLIKKPTIS
PAVGLVTKDPGKKPIFSAAVGLVSKDSGKKLGTGTTAVFINKDLGKKPGTITTVGLVSRE
SGKKLGIGIVPGLVSKESGKKLGLGTVVGLVNKDSVKKFGPAIGLVAKDCGKKTITNSSV
GLVNKDPAKKLVACPVAGLVNKDIVNLKAEALLPVQEPLKVSCNTNTSSHESQEHSESLK
DSATSKAFEKTIIRQNKDSLLEKFSIRKEIITLDKDIFNEGTCIQQDSFLSSERGTYVET
TKHEKQPPVYCTSPDFQMGGTSDASTAKSPFSAIGESNLPSPSPALSVTPLNRSPPGTSS
QLATNPLHLGPSTELIEGIAESIGKTQFSSENSHMNLGHRSLVHSMNTDCKGNDKELNDS
KASHTDNSRMGSSIGKKPSLASESSIHATITPSVVSFTSLFSSKPFLKIGAVTASEKHCQ
VAESLSTSLQSKPLKKRKGRKPRWTKVVARNTCRPSKGLELERSELFKNVSCSSLSNSNS
EPAKFMKNIGPSSFVEHDFLKCRLPKLSKSSTAPSLALLTETDKQSHKSFASHKLSSSIC
MSGDLLPDIYKPKRGRPKTKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEI
PSFKQSLSVSPFPKKRGRPKRQIRSPVKMKPPVLSVAPFVATESPSKLESESDKHRSSSD
FFERKDQLQGPDDSHKPSVCGMSDLEMEPDKKINKRNNGQLMKTIIRKINKMKTLKRKKL
LNQILSSSVESSNKGKVQSKLHNTVSTLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKA
VLNGILTSSPASLAVLEKTAHQVAGSALGQILPPLLPSAASSSEVLPSPICSQSSGTSGG
QSPVSSDAGFVEPSSVPYLHIHSRQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSEL
TSLKEATPSPISESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPET
STVLSSLKEKHKHKCKRRSHDYLSYDKMKRQKRKRKKKYPQLRNRQDPDFLAELEELISR
LSEIRITHRSHHFIPRDLLPTIFRINFNSFYTHPTFPLDPLHYIRKPDLKKKRGRPPKMR
EAMAEMPFMHSLSFPLSSTGFYPSYGMPYSPSPLAAAPIGLGYYGRYPPTLYPPPPSPSF
TTPLPPPSYMHAGHLLLNPAKYHKKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGW
MVEHKHRHRHKHREHRSSEQPQVSMDTLATNSSSRTVLESLKRYRFGKDAVGERYKHKEK
HRCHMSCPHLSPSKSLLSREEQWVHREPSESTSLALGLQTPLQIDCSETSPGLSLGGFTP
SSEPASSDEHTNLFTSAIGSCRVSNSTNTSGRKKLTDSPGLFTAQDTSLNRPLRKETLPS
NERALQTLTGSQPVLDKPSQRPSESTNCSPTRKRSSSESTSSTVIGIPSRGTRLGTSVDD
SVDSLLQRMAQHESQGTLEKNIDAVIATVSIPPSSSPGHTHGRERSLGKSDSLLVPTAPS
DSCSNTTTTISLLSERLPSSCSPHHLKRSVVEAMQRQARKMCNYNKILATKKNLDHVNKI
LKAKKLQRQARTGNNFVKRRPGRPRKYPLQAVVSMQAFQAAQFASPELDEGEEGRALHLG
PDTVTDVIEAVVQSVNLNPELRKGWKRKSWLLEEEARKRQKILPEEEQENNKSFPETTIE
SPSPPEAPPKPPEPENTLQPLPSLIPREKKAPRPPKKKYQKAGLYSDVYKTTDPKSRLIQ
LKKEKLEYTPGEHEYGLFPAPIHVGKYLRQKRIDFQLPYDILWQWKHNQLYKKPDVPLYK
KIRSNVYVDVKPLSGYEATTCNCKKPDDGDRKGCMDDCLNRMIFAECSPNTCPCGEQCCN
QRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNH
SDHYCLNLDSGMVIDSYRMGNEARFINHSCNPNCEMQKWSVNGVYRIGLYALKDMPAGTE
LTYDYNFHSFNVEKQQLCKCGFDKCRGIIGGKSQRMNGLTSKSSQPVTTHRRPGRSKEKR
KSKHKLKKRRGHLSEEPNENVSTPTRMTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQ
KQEEVKHTSDNIHSASLYTRWNGICRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEEN
IEVARAARLAQIFKEICDSIISYKDSSRQALATPLLNLPPKKKNADYYEKISDPLDLITI
EKQILTGYYKTVEAFDADMLKVFRNAEKYYGRKSPIGRDVCRLRKAYYNARHEASAQIDE
IVGETASEADSSETSVCEKENGHEKDDDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGV
NSDVEHYLCEQCDPRPVDREVPMIPRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSR
RTPDGHPVRQSYRLLSHINREKLDIFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRRF
YHNELFRVPLYEIIPLEAVVGTCCVLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYK
IHRNRYPVCTKPYAFDHFPKKLTPKRDFSPHYVPDNYKRNGGRSSWKTERSKPPIKDLGQ
EDDALPLIEEVLASQEQAANEMPTLEETDREVAPGETTEGEKKADESRQEPQRSCTPEER
RHSQRERLNQILLNLLEKIPGKNAIDVTYLLEEGSGRKLRRRTLLIPESSFRK
Download sequence
Identical sequences G3W6D3
ENSSHAP00000010988 ENSSHAP00000010988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]