SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012000 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012000
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-22
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012000   Gene: ENSSHAG00000010292   Transcript: ENSSHAT00000012098
Sequence length 299
Comment pep:novel scaffold:DEVIL7.0:GL849636.1:663523:686475:1 gene:ENSSHAG00000010292 transcript:ENSSHAT00000012098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHPADNTR
MELIIPGEQHFYMKAVNAAERQRWLVALGSAKACLTDTRAKKEKEISETNESLKTKMSEL
RLYCDLLMQQVHTIQEFVHHDDSHSSPSVENMNEASSLLSATCNTFITTLEECVKIANAK
FKPEMFQLPHPDPLVSPVSPSPVQMMKRSISHPGSYSSERSSHTVKEPGPSLHRISQRRR
RTYSDTDYNDMPPEDPDRPVHCSRNMLNGDLASATIPEEIRTVTKKRSELEDVPPSFSS
Download sequence
Identical sequences G3W995
ENSSHAP00000012000 ENSSHAP00000012000 XP_003764060.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]