SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012735 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012735
Domain Number 1 Region: 158-266
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-20
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 57-114
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000103
Family Voltage-gated potassium channels 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012735   Gene: ENSSHAG00000010899   Transcript: ENSSHAT00000012839
Sequence length 375
Comment pep:novel scaffold:DEVIL7.0:GL834742.1:765743:815643:1 gene:ENSSHAG00000010899 transcript:ENSSHAT00000012839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVFSALESPSEAAARERWGATLRNFSAAHDVGEDELLAFLRDYEAALAAGIRADALRPRW
DFTGAFYFVGTVVSTIGFGMTTPSTVAGKAFLIAYGLFGCAGTILFFNLFLERIISLLAF
IMRACHERQLRRSGLLPPAFRRGSALSEADSLVGWKPSVYHVMLILGIFAILLSCCASAM
YTSVEGWDYVDSLYYCFVTFSTIGFGDLVSSQHEAYRHQGLYRLGNFLFILMGVCCIYSL
FNVISIIIKQVLNWMLKKLSCQCCGRCRRPSSRLGRRNAITPGSRLRHHLNALEADGHYD
SDAEGRRLSGEMISMRDLIASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGAL
GIMNNRRSGEKKARF
Download sequence
Identical sequences G3WBD0
ENSSHAP00000012735 ENSSHAP00000012735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]