SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000013860 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000013860
Domain Number 1 Region: 4738-4896
Classification Level Classification E-value
Superfamily SET domain 1.44e-48
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 940-999
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000164
Family PHD domain 0.0035
Further Details:      
 
Domain Number 3 Region: 320-377
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000941
Family PHD domain 0.0026
Further Details:      
 
Domain Number 4 Region: 1012-1079
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000244
Family PHD domain 0.018
Further Details:      
 
Domain Number 5 Region: 888-948
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000266
Family PHD domain 0.012
Further Details:      
 
Domain Number 6 Region: 262-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000244
Family PHD domain 0.011
Further Details:      
 
Domain Number 7 Region: 389-452
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000202
Family PHD domain 0.022
Further Details:      
 
Domain Number 8 Region: 1598-1645
Classification Level Classification E-value
Superfamily HMG-box 0.0000447
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000013860   Gene: ENSSHAG00000011852   Transcript: ENSSHAT00000013977
Sequence length 4896
Comment pep:novel scaffold:DEVIL7.0:GL861668.1:919333:1101282:-1 gene:ENSSHAG00000011852 transcript:ENSSHAT00000013977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGLETAETENPVETAEVKEQSAEEDGDTEVDSNKQLTPALQRSVSEESTSSTVSVGVEA
KISEQLCAFCYCGERSSLGQGELKQFSPTPEFITTWKKQPLNKKDIGDNSDGTSEKIQNA
VPRKQRGQKKERSPRRSVTCVSVSTQTASDDQTGKLWDELSLVGLPDDIDFQALFESTGH
FWAHHRCAEWSLGICQAEEQALMNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQMYHY
PCAAGAGTFQDISNFSLLCPEHIDQAPERSKEEANCSVCDSPGDLGDQFFCTTCGQHYHG
MCLDIAVTALKRAGWQCPDCKVCQNCKHSGEDSKMLVCDTCDKGYHTFCLQPVMDSVPTN
GWKCKNCRICAECGTRTSSQWHHNCLVCDNCYQPQDNTACPFCGKCYQPDFQKDMLHCQM
CKRWIHIECDKPADTELDSQLKEDYVCMCCKQLGDLEPVQPCDEMETSETVPQSGTDSVN
EMETEGVDESLVFMDQAGSSSLNQDTRPEIASVAVHDCDEEQIKIKNVSPAVRLITDSPL
ILDLAQDKLNPEEQSEVSNQTDKDEMEMSDKTVQSYGEGQNENKMIMTENDNALTNSESS
PKDEKQQTLQESKATAFLEESPSPQLTPENIIGVSDILPPACEEDTALIAKMDLGIDKVQ
GAIEKDEICEVSSGIVEMECLPTFDDCLKVGSPLDEKSIISPSETDSAFSSAVDISKTNI
CSSIVSLDLTSANDILHSEPSNLHSSAGNMPTTYISVTPKIGMGKPAITKRKFSPGRPRS
KQGAWTTNNTVSPPSWSPDISEGREIFKPRQLTGSTIWSIKVGRGSGFPGKRRPRGAGLS
GRGGRGRSKLKSGIGALVLPGVSSMDILSSKDEEENSMHNTVVLFSSSDKFTLHQDMCVV
CGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPGRL
LLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSPGPRCEWQNNYTQCAPCA
SLSTCPVCSRNYREEDLILQCRQCDRWMHAVCQNLNTEDEVENVADIGFDCTMCRPYIPT
ANVPSSDCCESSIVAQIVTKVKELDPPKTYTQDGVCLTESGMSQLQSLTVTVPRKKRTKP
KLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGDLMDCDGKSDSSPEREAVDDETK
GAEGTDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSLTRKDSSGSVSEQLPVRDDGW
SEQLPDTLVDESIPISDSTEKIKKRYRKKKNKLEETFPAYLQEAFFGKDLLDTSRQNKLC
LDNLPEESVSQLSCKTNMSTNFLDPSSDPMLSSTSTPVKPGTQGNADDPLADLSEVLNTE
DDILGILSDDLVKSTDHSAGLDIGSISDDPSSLPQPNVNQSSRPLSEEQLDGILSPELDK
MVTDGAILGKLYKIPELGGKDVEDLFTAVLSPATTQPTPLPQPPPPPQLIPLHNQDGVFS
RMPLMNGLIGPNPHLPHNSLTPGNGIGTFSSITQSPYTDTRDKNPALNAMGNDPHISWPS
SAPIMEGEGDTLSNTQRSTLKWEKEEALGEIATVAPVLYTNINFPNLKEEFPDWATRVKQ
IAKLWRKASSQERAPYVQKARDNRAAQRINKVQMSNDSLKRQQQQDNIDPSSRIDSDLFK
DPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQQQQQFGSQPL
VNQSGSDTPSSGIQSPLTPQPGNGSMSPAQTFHKDLFTKPQLPGTPTTVASDDVFLKPQA
PPPPPAPVRIPVQDTLPQSQTPQSSSSHVFSSGSSSTRPLSPVDPYAKMVGTPRPLTGAQ
NFPRRNSGIPVETCPTSLSRSIQVTETTASRLSSVRDVCSSSASSDPYAKPPDTPRPMVT
DQFSKPLGILRPPIGMEQTGKNPLTAGTNDPFTKPSPRTDRFQRQRIPDPYPRPTLTPAP
VDSSNVPFKPPMHPPQSPQDPFGSVPQTPRRMSVDPYERPVLTPRPVDSFPHNQSNDSYG
QPPHTPHAAMNDSFAHPSRSFSQSGTLSRQTSQDPYSQPPGTPHPLADAFPQSSGTPRPI
KDPYSQPPATARPTTIDTYIPQSSTPIPSAQTDLFVPSSNNQRHSDPYAHPPGTPRPTMT
GPYSQVSAPPRPGIPESFNRSPLTRPGPVPNQDTFLQAAQNRGPTLPGTFVRSSDTCSQA
PRPPGPALSETFSHVPPSPAHDPYDQPPMTPRPQSDSFGTSQISHDVDQPRSGSEGNFTA
SSNSPMNSQGQQFSSIPQIPGPAPALAGTDTQNSTNMSPADTEKLRQRQKLREIILQQQQ
QKKNALRQEKGLQDPGSLPHWQPENLNPLFNRPPPPYPGNIRAPVAPPSGPRFPLFPKEQ
RGPFPSDVTALGMRHHGLRFGFPGGGHGPPSSQERFLVPSQQMQSPGVPPQLRRSLSVDM
PRPLNSSQMNNPVGLAQHFPPQGMQVQQHNILGQAFIELRHRVPDGRPRLPFNISASNVM
EPSSQHLRHGNIIPRPDFQGPRHIDPVRRTPQCVTNQLPIPTNLDHMQPSQQESGQTLHP
SPLALRSLSHAPGNDFVVNSLPTPVSSDESSNIQISSQPPDGLEEKLDPDDPSVKDIDVK
DLEGVEVKDLDDEDLENLNLDSEDGKGDELDTLGNLETNDPNLDDLLRSGEFDIIAYTDP
ELDLGDKKSMFNEELDLNVPIDDKLDVQCKTDEPKKNEKIGKVAVSSDKHSSKKKSTIIS
EIKTEVLSPNSQEEAKSEKEKSENSANIACTQLSTETELNEGEKTCAVTCNQDLIDNRTN
QENVGSNTNVQGSTKMPTEDVISACSITESTPVLSSLLANEKSDNSDMQPLASPPPSLPA
TQSNHVSGLPATLIPSSGPVLDHAMSSNMTVVSRMNHTFSQGMAINPGFIHSQSTNHSFG
TGQPNNQAVPVANPSGPSVMSGPQQLLLPQSVAQQNRERPLLLEEQPLLLQDLLDQERQE
QQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNMGMPPMVMNR
FPFMSGTQSSESQNLPQQAIAQDGSLTPQISRPNPPNFGPGFVNDSQRKQYEEWLQETQQ
LLQMQQKYLEEQIGLHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKRLE
QIRKQQKEHAELIEDYRIKQQQQCAMAPPVLIPGVQPQPTMVPGGSPAAISQPNFPIASQ
QLQHQQHTSVIPNQANPARMPNLPNWQPTNTPPRLPVSASRMQPPMPPIPIKTNAPAPGS
TSNSNPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRVLQQRI
EMEQHGMIGSELNNRSLSQIPFFNSELPCDFIPRPLQQSPQHQQQMGQVIQQQSMQQGSV
NSPPNQSFMQTNERRHIGPAPFGSEPPVLSGGPTFHSVKQPHGNLSGNNFPQGQIRPSFT
PGVSAAPQTANSGPPCGQETTVSHVQNYPGSSQSLIQLYSDIIPEEKGKKKRIRKKKKDD
DAESTKAPSTPHSDITAPPTPSISEPTSTPTVVTPNDLTPHLVEQESAEPLDSSATNEEV
NQTSSELEDNLSSSNFSQRNPHHQSTADTELVKFTSEVPKNIQEIKLEKAEAEQCPGQTE
PKLEDQTGIKTEEKVISSISSAQSPTQLVSVPPSKGDSGNELLKHLLKNKKTSSLLNKKS
EDSLKLEEEGSGNKLIEKHKSAEGLPTPGNRIQGGLGCGNNLQTKTDVLNETKKQRSKRT
QRTGEKGAPRSKKRKKDEEEKQSIYSNTDTFAHVKQQLSLLPLMEPIIGVNFAHFLPYGS
GQCNSGNRLLGTFGSATLEGVSDYYSQLIYKQNNLSNPPTPPASLPPTPPPVTCQKMANG
FATTEELAGRAGMLVGHDVSKALGPKQFPLPFKPQDDLLVRAMAQGPKTVDVPASLPTPP
HNNQEELRVQDPCSDRDTPESFVPSSSPESVVGMEISRYPDLSLVKEEPPEPVPSPVIPI
LPSSSGKGSEARQNDIKAEPGSGTLFFTSPFGPSQNGPKSGLISVAITLHPTAAENISSV
VAAFSDLLHVRIPNSYEVSNAPDIPSHVGLINGSRVNPGLEYRQQLLPHAPPPPVSMSHG
RLVASYKLKQPNIPFPPTSNGLAGYKDHNQNIADNSALRPQWCCHCKVVILGSGVRKSFK
SPGFLKQDSQESSDRGEKDIVFCSNNCFVLYSTTVQGKNSEHKESLPSLPHSPTKEMPPK
AFHQYNTNISTLDVHCLPQLQEKVSPPASPPITFPPALEAAKVEAKPDELKVTVKLKPRL
RAIHSAFDECRPLSKKWKGMKWKKWSIHIVIPKGTFKPPCEEEIDEFLKKRGTSLKPDPV
PKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALR
RGLQMKCVFCHKMGATGGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGTHEQE
LSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSSKAL
FPVGYEASRLYWSMRYANRRCRYLCSIEEKDGLPMFVIKIVEQGHEDLVLTDTSPKGVWD
KILEPVACVRKESEMLQLFPGYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNP
LMELPLAINPTGCARSEPKMSTHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFV
HSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEK
LYESQNRGVYMFRIDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRR
IQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
Download sequence
Identical sequences G3WEK5
ENSSHAP00000013860 ENSSHAP00000013860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]